Reactivity | HuSpecies Glossary |
Applications | ICC/IF |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPD |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | NANOG |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, pH 7.2, 40% glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Nanog Antibody (NBP3-21353)Find related products by research area.
|
Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax... Read full blog post. |
Deriving neural precursor cells from human induced pluripotent stem cells By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post. |
Stemness for Surviving Hypoxia: TGF-beta/Smad Signaling in Multiple Myeloma By Jamshed Arslan Pharm.D. Multiple myeloma (MM) is a cancer of antibody-producing plasma cells. The bone marrow (BM) of MM patients is hypoxic, and MM cells overexpress many cancerous genes that are regulated by hy... Read full blog post. |
KLF4 as a transcription factor in stem cell differentiation Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel... Read full blog post. |
Nanog is a Master Controller of ES cell Pluripotency Nanog, a homeodomain (HD) transcription factor, plays a critical role in the maintenance of embryonic stem (ES) cell self-renewal. Transcription regulator involved in inner cell mass and ES cell proliferation and self-renewal. Imposes pluripotency on ... Read full blog post. |
Sox2 and Oct4: Roles in Embryonic Stem Cell Pluripotency Embryonic stem (ES) cells are cells derived from the inner cell mass of the blastocyst, an early-stage embryo. ES cells are distinguished from other cells due to their pluripotency, which is the ability to differentiate into any different type of cell... Read full blog post. |
An Unlikely Pairing: The SOX2 Antibody and Breast Cancer SOX2 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors, which play a vital role in embryonic development. SOX2 antibody research has identified Sox2 as a key transcription factor in pluripotent stem cells. We at Novus B... Read full blog post. |
Fluorescence Activated Cell Sorting Antibody Techniques Recently, we at Novus Biologicals added several embryonic stem cell marker products to our antibody catalog, validated for use in fluorescent activated cell sorting (FACS) assays. They included Cripto1, PODXL, SSEA, OCT4, Nanog, SOX2, TRA-1, TERT and ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | NANOG |