n-Myc Antibody - BSA Free

Western Blot: n-Myc Antibody [NBP2-95112] - Analysis of extracts of HeLa cells, using MYCN antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Immunocytochemistry/Immunofluorescence: n-Myc Antibody [NBP2-95112] - Analysis of mouse brain using MYCN Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: n-Myc Antibody [NBP2-95112] - Analysis of rat brain using MYCN Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: n-Myc Antibody [NBP2-95112] - Mouse brain using MYCN antibody (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: n-Myc Antibody [NBP2-95112] - Rat brain using MYCN antibody (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

n-Myc Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit n-Myc Antibody - BSA Free (NBP2-95112) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 168-267 of human n-Myc (NP_005369.2). AGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYCN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Simple Western 1:25-1:100
  • Western Blot 1:100 - 1:500
• Application Notes: See Simple Western Antibody Database for Simple Western validation: Tested in KG-1 whole-cell lysate, separated by Size, antibody dilution of 1:25, 1:50, 1:100, apparent MW was 50 kDa
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for n-Myc Antibody - BSA Free

• BHLHE37
• bHLHe37N-myc proto-oncogene protein
• Class E basic helix-loop-helix protein 37
• MODED
• neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene
• N-myc
• NMYCneuroblastoma MYC oncogene
• ODED
• oncogene NMYC
• pp65/67
• v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived
• v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)

Background

n-Myc is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYCN