NDRG2 Antibody (6A5) - Azide and BSA Free

Images

 
Genetic Strategies: Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 downregulates GLUT1 by promoting its ubiquitination. ((B), (D) and (F) T-47D cells were transfected with NDRG2 small interfering RNA ...read more
Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 interacts with GLUT1. SK-BR-3 cells were fixed and incubated with primary antibodies against N-myc downstream-regulated gene 2 ...read more
Immunohistochemistry: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 is correlated with increased survival and negatively correlated with GLUT1 in breast carcinoma. Kaplan-Meier analysis was carried out according to N-myc ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 is correlated with increased survival and negatively correlated with GLUT1 in breast carcinoma. Kaplan-Meier analysis was carried out according to N-myc ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 inhibits cell proliferation and reduces the intracellular glucose levels of breast cancer cells. T-47D, MCF-7, Bcap37, MDA-MB-231 and SK-BR-3 cells were ...read more
Biological Strategies: Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 inhibits cell proliferation and reduces the intracellular glucose levels of breast cancer cells. Con siRNA. SK-BR-3 cells were ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 inhibits cell proliferation and reduces the intracellular glucose levels of breast cancer cells. SK-BR-3 cells with low NDRG2 expression were infected by an ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 interacts with GLUT1. Immunoprecipitation (IP) assays were performed with whole-cell lysates of SK-BR-3 cells pretreated with protein A-conjugated sepharose ...read more
Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 decreases the glucose uptake and GLUT1 protein levels in SK-BR-3-based subcutaneously xenograft tumours. The experiments illustrated ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - Analysis of NDRG2 expression in Hela S3 NE.
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 downregulates GLUT1 by promoting its ubiquitination. SK-BR-3 cells were infected with an adenovirus carrying N-myc downstream-regulated gene 2 (Ad-NDRG2) at 1, ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 decreases the glucose uptake and GLUT1 protein levels in SK-BR-3-based subcutaneously xenograft tumours. The experiments illustrated are described in the ...read more
ELISA: NDRG2 Antibody (6A5) [H00057447-M03] - Detection limit for recombinant GST tagged NDRG2 is approximately 0.03ng/ml as a capture antibody.
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 inhibits cell proliferation & reduces intracellular glucose levels of breast cancer cells. (E) & (F) SK-BR-3 cells cultured to glucose medium at concentrations ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 inhibits cell proliferation & reduces intracellular glucose levels of breast cancer cells. (A) T-47D, MCF-7, Bcap37, MDA-MB-231 & SK-BR-3 cells collected for ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 interacts with GLUT1. (A) SK-BR-3 cells were fixed & incubated with primary antibodies against N-myc downstream-regulated gene 2 (NDRG2) or glucose transporter ...read more
Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 decreases the glucose uptake & GLUT1 protein levels in SK-BR-3-based subcutaneously xenograft tumours. The experiments illustrated ...read more
Immunohistochemistry: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 is correlated with increased survival & negatively correlated with GLUT1 in breast carcinoma. Kaplan–Meier analysis was carried out according to N-myc ...read more
Immunocytochemistry/ Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 interacts with GLUT1. (A) SK-BR-3 cells were fixed & incubated with primary antibodies against N-myc downstream-regulated gene 2 ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 downregulates GLUT1 by promoting its ubiquitination. (A), (C) & (E) SK-BR-3 cells were infected with an adenovirus carrying N-myc downstream-regulated gene 2 ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 downregulates GLUT1 by promoting its ubiquitination. (A), (C) & (E) SK-BR-3 cells were infected with an adenovirus carrying N-myc downstream-regulated gene 2 ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 decreases the glucose uptake & GLUT1 protein levels in SK-BR-3-based subcutaneously xenograft tumours. The experiments illustrated are described in the Methods ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 inhibits cell proliferation & reduces intracellular glucose levels of breast cancer cells. (B) SK-BR-3 cells with low NDRG2 expression infected by an adenovirus ...read more
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 is correlated with increased survival & negatively correlated with GLUT1 in breast carcinoma. Kaplan–Meier analysis was carried out according to N-myc ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, Mycoplasma
Clone
6A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

NDRG2 Antibody (6A5) - Azide and BSA Free Summary

Description
Novus Biologicals Mouse NDRG2 Antibody (6A5) - Azide and BSA Free (H00057447-M03) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-NDRG2 Antibody: Cited in 20 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
Specificity
NDRG2 - NDRG family member 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDRG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using H00057447-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDRG2 Antibody (6A5) - Azide and BSA Free

  • DKFZp781G1938
  • FLJ25522
  • KIAA1248cytoplasmic protein Ndr1
  • NDR1-related protein NDR2
  • NDRG family member 2
  • protein NDRG2
  • Protein Syld709613
  • syld709613 protein
  • SYLDN-myc downstream regulator 2

Background

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NBP1-86636
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-45983
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
H00065009-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-86054
Species: Hu
Applications: IHC,  IHC-P
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF3200
Species: Hu
Applications: IHC, WB
314-BP
Species: Hu
Applications: BA, BA
NBP1-89679
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DY417
Species: Mu
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
NB100-77903
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
NB100-56681
Species: Hu, Mu, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for NDRG2 Antibody (H00057447-M03)(20)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 20. Show All 20 Publications.
Publications using H00057447-M03 Applications Species
Junbi H, Lin F, Mudan R et al. Colorectal Cancer Cell Differentiation Is Dependent on the Repression of Aerobic Glycolysis by NDRG2-TXNIP Axis. Dig Dis Sci. 2021-08-09 [PMID: 34373985]
Mingchao D, Xin B, Zhehao L et al. NDRG2 ablation reprograms metastatic cancer cells towards glutamine dependence via the induction of ASCT2. Int J Biol Sci. 2020-10-16 [PMID: 33162818]
Jin PP, Xia F, Ma BF et al. Spatiotemporal expression of NDRG2 in the human fetal brain. Ann Anat 2018-10-09 [PMID: 30312765]
Shen L, Qu X, Li H et al. NDRG2 facilitates colorectal cancer differentiation through the regulation of Skp2-p21/p27 axis. Oncogene 2018-01-18 [PMID: 29343851]
Ma J, Liu W, Guo H et al. N-myc downstream-regulated gene 2 expression is associated with glucose transport and correlated with prognosis in breast carcinoma. Breast Cancer Res. 2014-03-18 [PMID: 24636131]
Shen L, Qu X, Ma Y et al. Tumor suppressor NDRG2 tips the balance of oncogenic TGF-beta via EMT inhibition in colorectal cancer. Oncogenesis. 2014-02-03 [PMID: 24492480] (WB) WB
Langhi C, Pedraz-Cuesta E, Donate Y et al. Regulation of N-Myc downstream regulated gene 2 by bile acids. Biochem Biophys Res Commun. 2013-04-26 [PMID: 23541942]
Sun Z, Tong G, Ma N et al. NDRG2: a newly identified mediator of insulin cardioprotection against myocardial ischemia-reperfusion injury. Basic Res Cardiol. 2013-03-06 [PMID: 23463182]
Li Y, Xu N, Cai L et al. NDRG2 Is a Novel p53-Associated Regulator of Apoptosis in C6-Originated Astrocytes Exposed to Oxygen-Glucose Deprivation. PLoS One. 2013-02-22 [PMID: 23451161]
Kim KD, Oh SS, Kim D et al. NDRG2 correlated with favorable recurrence-free survival inhibits metastasis of mouse breast cancer cells via attenuation of active TGF-b production. Carcinogenesis. 2012-06-13 [PMID: 22696597]
Show All 20 Publications.

Reviews for NDRG2 Antibody (H00057447-M03) (0)

There are no reviews for NDRG2 Antibody (H00057447-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDRG2 Antibody (H00057447-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDRG2 Products

Research Areas for NDRG2 Antibody (H00057447-M03)

Find related products by research area.

Blogs on NDRG2

There are no specific blogs for NDRG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG2 Antibody (6A5) - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NDRG2
Entrez
OMIM
Uniprot