MYRF Antibody - BSA Free

Western Blot: MYRF Antibody [NBP3-05627] - Western blot analysis of extracts of various cell lines, using MYRF Rabbit pAb (NBP3-05627) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MYRF Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYRF (NP_001120864.1). MEVVDETEALQRFFEGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASSASYSHGQPAMPGSSGVHHLSPPGGGPSPGRHGPLPPPGYGTPLN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYRF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Western Blot 1:500-1:2000
• Theoretical MW: 124 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for MYRF Antibody - BSA Free

• 11orf9
• C11orf9
• CUGS
• MMERV
• MRF
• myelin regulatory factor
• Ndt80
• pqn-47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MYRF