Myosin heavy chain 13 Antibody - Azide and BSA Free

Western Blot: Myosin heavy chain 13 Antibody [NBP3-05614] - Western blot analysis of extracts of various cell lines, using Myosin heavy chain 13 antibody (NBP3-05614) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 13 Antibody - Azide and BSA Free [NBP3-05614] - Immunofluorescence analysis of paraffin-embedded rat eye using Myosin heavy chain 13 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 13 Antibody - Azide and BSA Free [NBP3-05614] - Immunofluorescence analysis of paraffin-embedded mouse eye using Myosin heavy chain 13 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Myosin heavy chain 13 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Myosin heavy chain 13 Antibody - Azide and BSA Free (NBP3-05614) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1240-1320 of human Myosin heavy chain 13 (NP_003793.2). EALSKSKSNIERTCRTVEDQFSEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKESLISQLTKSKQALTQQLEELK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYH13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Immunohistochemistry 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 223 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Myosin heavy chain 13 Antibody - Azide and BSA Free

• MYH13
• MYH13 myosin, heavy chain 13, skeletal muscle
• MyHC-eo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MYH13