Musculin Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Musculin (NP_034957). Peptide sequence IAHLRQLLQEDRYEDSYVHPVNLTWPFVVSGRPDSDSKDVSAANRLCGTS |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MSC |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Musculin Antibody - BSA Free
Background
Differentiation of myogenic cells is regulated by multiple positively and negatively acting factors. One well characterized family of helix-loop-helix (HLH) proteins, known to play an important role in the regulation of muscle cell development, includes MyoD, myogenin and musculin (also designated MyoR). Members of this group of transcription factors form heterodimers with products of a more widely expressed family of bHLH genes, the E family, which consists of at least three distinct genes: E2A, IF2 and HEB. MyoD-E or musculin-E heterodimers bind avidly to consensus E box motifs, which are functionally important elements in the promoter regions of many musclespecific terminal differentiation genes. MyoD complexes potently induce transcriptional activation, while musculin complexes bind adjacent to MyoD DNA-binding regions to represses MyoD activity, which then results in the delayed expression of muscle-specific genes. Musculin is highly expressed in undifferentiated and proliferating myoblasts in culture, and its expression is down regulated during myogenesis and at the onset of terminal differentiation
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IP, WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Publications for Musculin Antibody (NBP3-10419) (0)
There are no publications for Musculin Antibody (NBP3-10419).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Musculin Antibody (NBP3-10419) (0)
There are no reviews for Musculin Antibody (NBP3-10419).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Musculin Antibody (NBP3-10419) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Musculin Products
Blogs on Musculin