Muscleblind-like 1 Antibody - BSA Free

Western Blot: Muscleblind-like 1 Antibody [NBP2-55165] - Analysis in human cell line THP-1.

Immunocytochemistry/Immunofluorescence: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human prostate shows moderate nuclear positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Muscleblind-like 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Muscleblind-like 1 Antibody - BSA Free (NBP2-55165) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Muscleblind-like 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPA
• Predicted Species: Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MBNL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Muscleblind-like 1 Recombinant Protein Antigen (NBP2-55165PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Muscleblind-like 1 Antibody - BSA Free

• DKFZp686P06174
• EXP40
• EXP42
• EXPKIAA0428EXP35
• MBNL
• muscleblind (Drosophila)-like
• muscleblind-like (Drosophila)
• muscleblind-like protein 1
• Triplet-expansion RNA-binding protein

Background

Several important human diseases are associated with expansion of polynucleotide sequences, in most cases trinucleotide repeats. Myotonic dystrophy (DM1) is one of these diseases, and is associated with increases in the number of CTG repeats in the UTR of the gene encoding myotonin (a.k.a. DM Kinase, DMK or myotonin-Protein Kinase), a ser/thr kinase expressed specifically in muscle. Mammalian genomes contain three muscleblind-like proteins, generally referred to as MBNL1, MBNL2 and MBNL3, and all three were found to associate with long double stranded CUG RNA repeats, thus, being triplet repeat expansion dsRNA-binding proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Muscleblind-like 1 Antibody (NBP2-55165)(1)

Publication using NBP2-55165

• Pierre M, Djemai M, Chapotte-Baldacci CA et al. Cardiac involvement in patient-specific induced pluripotent stem cells of myotonic dystrophy type 1: unveiling the impact of voltage-gated sodium channels Frontiers in physiology 2023-09-18 [PMID: 37791351] (WB, ISH, Human)

Bioinformatics

• Gene Symbol: MBNL1