MBNL2 Antibody

Western Blot: MBNL2 Antibody [NBP1-79451] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Western Blot: MBNL2 Antibody [NBP1-79451] - Human Brain lysate, concentration 0.2-1 ug/ml.

Western Blot: MBNL2 Antibody [NBP1-79451] - Hela, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that MBNL2 is expressed in HeLa.

Western Blot: MBNL2 Antibody [NBP1-79451] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MBNL2 Antibody Summary

• Immunogen: Synthetic peptide directed towards the middle region of human MBNL2The immunogen for this antibody is MBNL2. Peptide sequence ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MBNL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against MBNL2 and was validated on Western blot.
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MBNL2 Antibody

• DKFZp781H1296
• MBLL39Muscleblind-like protein 1
• MBLLMGC120628
• MGC120625
• MGC120626
• MLP1
• muscleblind-like 2 (Drosophila)
• muscleblind-like protein 2
• Muscleblind-like protein-like 39
• Muscleblind-like protein-like
• PRO2032

Background

MBNL2 encodes a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein. Drosophila muscleblind is a gene required for photoreceptor differentiation. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MBNL2