Muscleblind-like 1 Antibody

Images

 
Western Blot: Muscleblind-like 1 Antibody [NBP1-80489] - Titration: 2.5ug/ml, Positive Control: Jurkat cell lysate.
Immunohistochemistry: Muscleblind-like 1 Antibody [NBP1-80489] - Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic, nucleus Primary Antibody Concentration: 1:100 Other Working Concentrations: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Muscleblind-like 1 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human MBNL1. Peptide sequence LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MBNL1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MBNL1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Muscleblind-like 1 Antibody

  • DKFZp686P06174
  • EXP40
  • EXP42
  • EXPKIAA0428EXP35
  • MBNL
  • muscleblind (Drosophila)-like
  • muscleblind-like (Drosophila)
  • muscleblind-like protein 1
  • Triplet-expansion RNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6967
Species: Hu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
291-G1
Species: Hu
Applications: BA
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-57531
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-316
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-31225
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-42632
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
210-TA
Species: Hu
Applications: BA
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-79451
Species: Hu
Applications: WB
MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-80489
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Muscleblind-like 1 Antibody (NBP1-80489) (0)

There are no publications for Muscleblind-like 1 Antibody (NBP1-80489).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Muscleblind-like 1 Antibody (NBP1-80489) (0)

There are no reviews for Muscleblind-like 1 Antibody (NBP1-80489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Muscleblind-like 1 Antibody (NBP1-80489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Muscleblind-like 1 Products

Bioinformatics Tool for Muscleblind-like 1 Antibody (NBP1-80489)

Discover related pathways, diseases and genes to Muscleblind-like 1 Antibody (NBP1-80489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscleblind-like 1 Antibody (NBP1-80489)

Discover more about diseases related to Muscleblind-like 1 Antibody (NBP1-80489).
 

Pathways for Muscleblind-like 1 Antibody (NBP1-80489)

View related products by pathway.

PTMs for Muscleblind-like 1 Antibody (NBP1-80489)

Learn more about PTMs related to Muscleblind-like 1 Antibody (NBP1-80489).
 

Research Areas for Muscleblind-like 1 Antibody (NBP1-80489)

Find related products by research area.

Blogs on Muscleblind-like 1

There are no specific blogs for Muscleblind-like 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Muscleblind-like 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MBNL1
Uniprot