MUC2 Antibody (4L5Y8) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 5000-5100 of human MUC2 (Q02817). PDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
MUC2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunohistochemistry 1:500 - 1:2000
- Immunohistochemistry-Paraffin 1:500 - 1:2000
- Western Blot 1:1000 - 1:2000
|
| Theoretical MW |
55 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MUC2 Antibody (4L5Y8)
Background
MUC2, also called mucin 2, is a member of the mucin protein family which are heavily glycosylated, high molecular weight proteins that are produced by goblet cells in epithelial tissues including the intestinal and respiratory tract (1). Mucins can form gels and function in lubrication of mucosal surfaces which serve as a protective barrier of the epithelial lining and an innate host defense (1). Mucins are divided into two groups based on whether they are membrane-bound or secreted, where MUC2 belongs to the secretory group (1,2). Secreted mucins have a distinctive composition characterized by a large central exon "mucin domain" containing O-glycosylated tandem repeat regions rich in proline, threonine, and serine residues, non-repetitive domains, and cysteine-rich domains (1,2). The mucin domain is flanked by 5' and 3' D domains, a B-like domain, a C-like domain, and a Ck-domain (1,2). MUC2 was the first secretory mucin identified in humans (3,4). Full-length MUC2 protein is synthesized as 5179 amino acids (aa) in length with a theoretical molecular weight of ~540 kDa (5).
Changes or perturbations to MUC2 expression has been associated with a number of disease pathologies (1-4, 6). Specifically, altered MUC2 composition has been indicated in colorectal cancer, inflammatory bowel diseases (IBD) including ulcerative colitis and Chron's disease, and chronic obstructive pulmonary disease (COPD) (1-4, 6). In general, decreased or reduced MUC2 expression is associated with colorectal cancer disease progression and development of IBD (1-4, 6). Additionally, studies have found that upon intestinal infection due to parasites or bacteria MUC2 expression is increased, as is overall mucus secretion (3, 6).
References
1. Pothuraju, R., Krishn, S. R., Gautam, S. K., Pai, P., Ganguly, K., Chaudhary, S., Rachagani, S., Kaur, S., & Batra, S. K. (2020). Mechanistic and Functional Shades of Mucins and Associated Glycans in Colon Cancer. Cancers. https://doi.org/10.3390/cancers12030649
2. Ballester, B., Milara, J., & Cortijo, J. (2019). Mucins as a New Frontier in Pulmonary Fibrosis. Journal of Clinical Medicine. https://doi.org/10.3390/jcm8091447
3. Liu, Y., Yu, X., Zhao, J., Zhang, H., Zhai, Q., & Chen, W. (2020). The role of MUC2 mucin in intestinal homeostasis and the impact of dietary components on MUC2 expression. International Journal of Biological Macromolecules. https://doi.org/10.1016/j.ijbiomac.2020.07.191
4. Allen, A., Hutton, D. A., & Pearson, J. P. (1998). The MUC2 gene product: a human intestinal mucin. The International Journal of Biochemistry & Cell Biology. https://doi.org/10.1016/s1357-2725(98)00028-4
5. Uniprot (Q02817)
6. Kim, Y. S., & Ho, S. B. (2010). Intestinal goblet cells and mucins in health and disease: recent insights and progress. Current Gastroenterology Reports. https://doi.org/10.1007/s11894-010-0131-2
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB (-)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for MUC2 Antibody (NBP3-16481) (0)
There are no publications for MUC2 Antibody (NBP3-16481).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MUC2 Antibody (NBP3-16481) (0)
There are no reviews for MUC2 Antibody (NBP3-16481).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MUC2 Antibody (NBP3-16481) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MUC2 Products
Research Areas for MUC2 Antibody (NBP3-16481)
Find related products by research area.
|
Blogs on MUC2