MUC5B Antibody - BSA Free

Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Analysis in human cervix, uterine and skeletal muscle tissues. Corresponding MUC5B RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: MUC5B Antibody [NBP1-92151] - Staining of human cell line A549 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human gallbladder shows very strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human gallbladder shows very strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human lower gastrointestinal shows strong extracellular space positivity in glandular cells.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human cervix, uterine shows very strong extracellular space positivity in glandular cells.

Analysis in human cervix, uterine and skeletal muscle tissues using NBP1-92151 antibody. Corresponding MUC5B RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MUC5B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MUC5B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MUC5B Recombinant Protein Antigen (NBP1-92151PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MUC5B Antibody - BSA Free

• high molecular weight salivary mucin MG1
• mucin 5, subtype B, tracheobronchial
• mucin 5B, oligomeric mucus/gel-forming
• sublingual gland mucin
• tracheobronchial

Background

MUC5B, also known as Mucin 5B, is a long 5762 amino acid protein that is 596 kDa, expressed on surface airway epithelia, it is a major contributor to the lubricating and viscoelastic properties of whole saliva, normal lung mucus and cervical mucus. Disease research is being performed in relation to MUC5B and chronic obstructive pulmonary disease, cervicitis, sinusitis, polyposis, pseudomyxoma peritonei, otitis media, dry eye syndrome, ampulla of vater carcinoma, common cold, copd, dental caries, diffuse panbronchiolitis, biliary papillomatosis, panbronchiolitis, atrophic gastritis, Barrett's esophagus, cystic fibrosis lung disease, peptic ulcer, bronchitis, gastritis, sinusitis, asthma, laryngitis, and nasopharyngitis. This protein has been shown to have interactions with AMY1A, AMY1B, AMY1C, HTN1, STATH, and over 40 other proteins in Addition of GalNAc to the Tn antigen via an alpha-1,6 linkage forms a Core 7 glycoprotein, O-linked glycosylation of mucins, Metabolism of proteins, Post-translational protein modification, Addition of galactose to the Tn antigen via an alpha-1,3 linkage forms a Core 8 glycoprotein, Addition of GlcNAc to the Tn antigen via a beta-1,6 linkage forms a Core 6 glycoprotein, Termination of O-glycan biosynthesis, Salivary secretion, Mucin expression in CF via TLRs, EGFR signaling pathways, Mucin expression in CF via IL-6, IL-17 signaling pathways, and Selected targets of CREB1 pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MUC5B Antibody (NBP1-92151)(9)

Publications using NBP1-92151

• Gry M, Oksvold P, Ponten F et al. Tissue specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010-01-01
• Cao W, Li J, Che L et al. Single-cell transcriptomics reveals e-cigarette vapor-induced airway epithelial remodeling and injury Respiratory Research 2024-09-28 [PMID: 39342154]
• Yong-Shun Ye, Di-Fei Chen, Ming Liu, Yu-Long Luo, Huan-Jie Chen, Hai-Kang Zeng, Jing-Wei Liu, Yi-Ping Zhu, Xin-Yu Song, Chang-Qin Lin, Zhu-Quan Su, Shi-Yue Li Autologous Airway Basal Cell Transplantation Alleviates Airway Epithelium Defect in Recurrent Benign Tracheal Stenosis Stem Cells Translational Medicine 2023-12-01 [PMID: 37804518]
• Takahashi J, Mizutani T, Sugihara H et al. Suspension culture in a rotating bioreactor for efficient generation of human intestinal organoids Cell reports methods 2022-11-21 [PMID: 36452871] (IF/IHC, Human)
• Yusuke Ueda, Haruta Mogami, Yosuke Kawamura, Masahito Takakura, Asako Inohaya, Eriko Yasuda, Yu Matsuzaka, Yoshitsugu Chigusa, Shinji Ito, Masaki Mandai, Eiji Kondoh Cervical MUC5B and MUC5AC are Barriers to Ascending Pathogens During Pregnancy. The Journal of clinical endocrinology and metabolism 2022-11-24 [PMID: 36112402]
• Tan Y, Flynn W, Sivajothi S Et al. Single cell analysis of endometriosis reveals a coordinated transcriptional program driving immunotolerance and angiogenesis across eutopic and ectopic tissues Nat Cell Biol 2022-07-21 [PMID: 35864314]
• Yin W, Liontos A, Koepke J et al. An essential function for autocrine Hedgehog signaling in epithelial proliferation and differentiation in the trachea bioRxiv 2022-01-01 [PMID: 35112129] (ICC/IF, Human)
• Carrer M, Crosby Jr, Sun G et Al. Antisense Oligonucleotides Targeting Jagged 1 Reduce House Dust Mite-Induced Goblet Cell Metaplasia in the Adult Murine Lung Am. J. Respir. Cell Mol. Biol. 2020-03-16 [PMID: 32176858]
• Meyerholz DK, Stoltz DA, Namati E et al. Loss of cystic fibrosis transmembrane conductance regulator function produces abnormalities in tracheal development in neonatal pigs and young children. Am J Respir Crit Care Med 2010-11-01 [PMID: 20622026]

Bioinformatics

• Gene Symbol: MUC5B