Home » MUC5B » MUC5B Antibodies » MUC5B Antibody

MUC5B Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Analysis in human cervix, uterine and skeletal muscle tissues. Corresponding MUC5B RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Analysis in human cervix, uterine and skeletal muscle tissues. Corresponding MUC5B RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: MUC5B Antibody [NBP1-92151] - Staining of human cell line A549 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human gallbladder shows very strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human gallbladder shows very strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human lower gastrointestinal shows strong extracellular space positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

MUC5B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
Specificity
Specificity of human Mucin 5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUC5B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MUC5B Recombinant Protein Antigen (NBP1-92151PEP)
Publications
Read Publications using NBP1-92151.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUC5B Antibody

  • high molecular weight salivary mucin MG1
  • mucin 5, subtype B, tracheobronchial
  • mucin 5B, oligomeric mucus/gel-forming
  • sublingual gland mucin
  • tracheobronchial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MUC5AC Antibody
(45M1)
NBP2-15196
Western Blot: MUC5AC Antibody (45M1) [NBP2-15196] - AGS human gastric adenocarcinoma and KATO-III human gastric carcinoma cell line lysates. Image from verified customer review.
Immunohistochemistry-Paraffin: MUC5AC Antibody (45M1) [NBP2-15196] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC5AC Monoclonal Antibody (45M1).
Flow Cytometry: MUC5AC Antibody (45M1) [NBP2-15196] - An intracellular stain was performed on A549 cells with Mucin 5AC (45M1) antibody NBP2-15196PE (blue) and a matched isotype control NBP2-27287PE (orange). To block the secretion of Mucin 5AC, cells were treated with 3uM Monensin for 3 hours. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both Antibodies were conjugated to Phycoerythrin.
(4 Reviews)
(11 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
MUC2 Antibody
(996/1)
NB120-11197
Immunocytochemistry/Immunofluorescence: MUC2 Antibody (996/1) [NB120-11197] - MS-induced intestinal epithelium injury was CRHR1 dependent.Photomicrographs of immunofluorescence of Mucin 2 (Muc2; mucous-forming protein) (F-J) in proximal colon in all experimental groups. Image collected and cropped by CiteAb from the following publication (nature.com/articles/srep46616), licensed under a CC-BY licence.
Flow Cytometry: MUC2 Antibody (996/1) [NB120-11197] - An intracellular stain was performed on HeLa cells with MUC2 Antibody [996/1] NB120-11197AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: MUC2 Antibody (996/1) [NB120-11197] - MS-induced intestinal epithelium injury was CRHR1 dependent. Photomicrographs of immunofluorescence of Mucin 2 (Muc2; mucous-forming protein) (F-J) in proximal colon in all experimental groups. Image collected and cropped by CiteAb from the following publication (nature.com/articles/srep46616), licensed under a CC-BY licence.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
MUC1 Antibody (SM3)
NB120-22711
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MUC1 [SM3] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MUC-1 Antibody (SM3) [NB120-22711] - IHC analysis of formalin fixed paraffin embedded tissue section of human breast cancer xenograft using MUC-1 antibody clone SM3 at 1:10 dilution. The xenograft section depicted a very specific and intense signal in the periphery of the cancer cells. The necrotic cells also developed a strong immune-positivity while the tumor stroma as well as the nuclei of cells were negative for immunostaining.
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MUC-1 antibody was tested in MCF7 cells at 10 ug/ml using a Dylight 488 conjugated secondary antibody (Green). Actin (Red) and DNA (Blue) were counterstained using Phalloidin 568 and DAPI.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MUC7 Antibody
(4D2-1D7)
NBP2-50391
MUC7 Antibody (4D2-1D7)
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC, PAGE
MUC4 Antibody
NBP1-52193
Western Blot: MUC4 Antibody [NBP1-52193] - MUC4 is shown in the green channel, with beta-tubulin in red channel and Precision Plus dual color protein ladder in the left. The main band is about 60 kDa, with another band about 40 kDa. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MUC4 Antibody [NBP1-52193] - Staining of MUC4 in HepG2 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: MUC4 Antibody [NBP1-52193] - Staining of MUC4 in mouse prostate
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MUC6 Antibody
(CLH5)
NBP2-44374
Immunohistochemistry-Paraffin: MUC6 Antibody (CLH5) [NBP2-44374] - Human Gastric Carcinoma stained with MUC6 Monoclonal Antibody (CLH5).
Immunohistochemistry-Paraffin: MUC6 Antibody (CLH5) [NBP2-44374] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC6 Antibody (CLH5). Courtesy of Dr. Leonor David, IPATIMUP and Medical Faculty, University of Porto, Portugal
(1 Publication)
Species: Hu
Applications: Flow, IHC, IHC-P, IF
MUC3 Antibody
(M3.1) - IHC-Predilut
NBP2-48392
Immunohistochemistry-Paraffin: MUC3 Antibody (M3.1) - IHC-Prediluted [NBP2-48392] - Formalin-fixed, paraffin-embedded human Colon Carcinoma stained with MUC3 Mouse Monoclonal Antibody (M3.1).
Immunohistochemistry-Paraffin: MUC3 Antibody (M3.1) - IHC-Prediluted [NBP2-48392] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC3 Mouse Monoclonal Antibody (M3.1).
Immunohistochemistry-Paraffin: MUC3 Antibody (M3.1) - IHC-Prediluted [NBP2-48392] - Formalin-fixed, paraffin-embedded human Gastric Carcinoma stained with MUC3 Mouse Monoclonal Antibody (M3.1).
Species: Hu
Applications: IHC, IHC-P
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(11 Reviews)
(41 Publications)
Species: Hu
Applications: WB, IHC, IP
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
IL-13 [HRP]
M1300CB
(3 Reviews)
(114 Publications)
Species: Mu
EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(5 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
DMBT1/GP340
Antibody (548012)
MAB59151
Western blot shows lysates of mouse small intestine tissue. PVDF Membrane was probed with 2 µg/mL of Mouse DMBT1 Monoclonal Antibody (Catalog # MAB59151) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for DMBT1 at approximately 210 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Mu
Applications: WB
Lactoferrin
Antibody (1C6)
NB120-10109
CyTOF-ready: Lactoferrin Antibody (1C6) [NB120-10109] - Human bone marrow after RBC lysis, stained with anti-CD16, fixed, permeabilized with methanol, stained with anti-lactoferrin 1C6 NB120-10109 and anti-rRNA Y10b NB100-662, and gated on myeloid cells per Nat Med. 2020. 26:408-417. CyTOF image submitted by a verified customer review.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
Von Willebrand
Factor Antibody
NB600-586
Dual RNAscope ISH-IHC: Von Willebrand Factor Antibody [NB600-586] - Formalin-fixed paraffin-embedded tissue sections of human metastatic tonsil were probed for vWF mRNA (ACD RNAScope probe, catalog # 5860461; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus catalog # NB600-586) at 1:500 dilution for 1 hour at room temperature followed by incubation with the anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).
Immunohistochemistry: Von Willebrand Factor Antibody [NB600-586] - Formalin fixed paraffin embedded human tonsil stained with Factor VIII antibody.
Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody [NB600-586] - Staining of formalin-fixed, paraffin-embedded Human Kidney sections with 1:2,000 Rabbit Anti-von Willebrand Factor.
(3 Reviews)
(4 Publications)
Species: Hu, Mu, Ca, Fe
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC
Lysozyme Antibody
NBP2-61118
Western Blot: Lysozyme Antibody [NBP2-61118] - Total protein from human cell lines THP-1 and HepG2, human stomach and kidney as well as mouse kidney was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Lysozyme in 5% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Lysozyme Antibody [NBP2-61118] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-Lysozyme at 2 ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Lysozyme Antibody [NBP2-61118] - Analysis of a FFPE tissue section of human kidney with Lysozyme antibody at 1:100 dilution. The staining was developed with HRP-DAB detection method and the counterstaining was performed using hematoxylin. This Lysozyme antibody generated an expected cytoplasmic staining in all the cells with strongest signal in tubular epithelial cells. Some tubules showed more of a punctate staining pattern (vesicular Lysozyme) while all of the tubules depicted a diffused signal (secreted Lysozyme). A subset of cells, especially those from glomeruli, showed nuclear positivity also.
(1 Publication)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
CA125/MUC16
Antibody (X75)
NB600-1468
CA125/MUC16 Antibody (X75)
(3 Publications)
Species: Hu
Applications: WB, S-ELISA
STATH Antibody
NBP1-92450
Immunohistochemistry-Paraffin: STATH Antibody [NBP1-92450] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: STATH Antibody [NBP1-92450] - Staining of human salivary gland shows high expression.
Immunohistochemistry-Paraffin: STATH Antibody [NBP1-92450] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P

Publications for MUC5B Antibody (NBP1-92151)(3)


Reviews for MUC5B Antibody (NBP1-92151) (0)

There are no reviews for MUC5B Antibody (NBP1-92151). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MUC5B Antibody (NBP1-92151) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional MUC5B Products

Bioinformatics Tool for MUC5B Antibody (NBP1-92151)

Discover related pathways, diseases and genes to MUC5B Antibody (NBP1-92151). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC5B Antibody (NBP1-92151)

Discover more about diseases related to MUC5B Antibody (NBP1-92151).
 

Pathways for MUC5B Antibody (NBP1-92151)

View related products by pathway.

PTMs for MUC5B Antibody (NBP1-92151)

Learn more about PTMs related to MUC5B Antibody (NBP1-92151).

Blogs on MUC5B

There are no specific blogs for MUC5B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUC5B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MUC5B