Orthogonal Strategies: Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Analysis in human cervix, uterine and skeletal muscle tissues. Corresponding MUC5B RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: MUC5B Antibody [NBP1-92151] - Staining of human cell line A549 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human gallbladder shows very strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human gallbladder shows very strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MUC5B Antibody [NBP1-92151] - Staining of human lower gastrointestinal shows strong extracellular space positivity in glandular cells.
Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Staining of human cervix, uterine shows very strong extracellular space positivity in glandular cells.
Orthogonal Strategies: Analysis in human cervix, uterine and skeletal muscle tissues using NBP1-92151 antibody. Corresponding MUC5B RNA-seq data are presented for the same tissues.
This antibody was developed against Recombinant Protein corresponding to amino acids: CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUC5B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for MUC5B Antibody - BSA Free
high molecular weight salivary mucin MG1
mucin 5, subtype B, tracheobronchial
mucin 5B, oligomeric mucus/gel-forming
sublingual gland mucin
tracheobronchial
Background
MUC5B, also known as Mucin 5B, is a long 5762 amino acid protein that is 596 kDa, expressed on surface airway epithelia, it is a major contributor to the lubricating and viscoelastic properties of whole saliva, normal lung mucus and cervical mucus. Disease research is being performed in relation to MUC5B and chronic obstructive pulmonary disease, cervicitis, sinusitis, polyposis, pseudomyxoma peritonei, otitis media, dry eye syndrome, ampulla of vater carcinoma, common cold, copd, dental caries, diffuse panbronchiolitis, biliary papillomatosis, panbronchiolitis, atrophic gastritis, Barrett's esophagus, cystic fibrosis lung disease, peptic ulcer, bronchitis, gastritis, sinusitis, asthma, laryngitis, and nasopharyngitis. This protein has been shown to have interactions with AMY1A, AMY1B, AMY1C, HTN1, STATH, and over 40 other proteins in Addition of GalNAc to the Tn antigen via an alpha-1,6 linkage forms a Core 7 glycoprotein, O-linked glycosylation of mucins, Metabolism of proteins, Post-translational protein modification, Addition of galactose to the Tn antigen via an alpha-1,3 linkage forms a Core 8 glycoprotein, Addition of GlcNAc to the Tn antigen via a beta-1,6 linkage forms a Core 6 glycoprotein, Termination of O-glycan biosynthesis, Salivary secretion, Mucin expression in CF via TLRs, EGFR signaling pathways, Mucin expression in CF via IL-6, IL-17 signaling pathways, and Selected targets of CREB1 pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our MUC5B Antibody - BSA Free and receive a gift card or discount.