MUC7 Antibody

Images

 
Immunohistochemistry-Paraffin: MUC7 Antibody [NBP1-82045] - Staining of human small intestine shows low expression as expected.
Immunohistochemistry-Paraffin: MUC7 Antibody [NBP1-82045] - Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MUC7 Antibody [NBP1-82045] - Staining in human salivary gland and small intestine tissues using anti-MUC7 antibody. Corresponding MUC7 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MUC7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAP
Specificity
Specificity of human MUC7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUC7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MUC7 Protein (NBP1-82045PEP)
Publications
Read Publication using NBP1-82045.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUC7 Antibody

  • apo-MG2
  • DKFZp686J03256
  • FLJ27047
  • MG2MGC34772
  • MUC-7
  • mucin 7, secreted
  • mucin-7
  • Salivary mucin-7
  • salivary

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44374
Species: Hu
Applications: Flow, IHC, IHC-P, IF
NBP2-47687
Species: Hu, Rt(-)
Applications: Flow, IHC, IHC-P, CyTOF-ready, IF
NB120-10109
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
MAB59151
Species: Mu
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB200-125
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85599
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, S-ELISA
NBP2-70481
Species: Hu
Applications: WB, Flow, ICC/IF, CyTOF-ready
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
NBP1-82045
Species: Hu
Applications: IHC, IHC-P

Publications for MUC7 Antibody (NBP1-82045)(1)


Reviews for MUC7 Antibody (NBP1-82045) (0)

There are no reviews for MUC7 Antibody (NBP1-82045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUC7 Antibody (NBP1-82045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MUC7 Products

Bioinformatics Tool for MUC7 Antibody (NBP1-82045)

Discover related pathways, diseases and genes to MUC7 Antibody (NBP1-82045). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC7 Antibody (NBP1-82045)

Discover more about diseases related to MUC7 Antibody (NBP1-82045).
 

Pathways for MUC7 Antibody (NBP1-82045)

View related products by pathway.

PTMs for MUC7 Antibody (NBP1-82045)

Learn more about PTMs related to MUC7 Antibody (NBP1-82045).

Blogs on MUC7

There are no specific blogs for MUC7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUC7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC7
Entrez
Uniprot