MTCH2 Antibody

Images

 
Immunohistochemistry-Paraffin: MTCH2 Antibody [NBP1-89482] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTCH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTCH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MTCH2 Protein (NBP1-89482PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTCH2 Antibody

  • 2310034D24Rik
  • Met-induced mitochondrial protein
  • MIMP
  • mitochondrial carrier 2
  • mitochondrial carrier homolog 2 (C. elegans)
  • mitochondrial carrier homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-14148
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5394
Species: Hu, Mu
Applications: WB
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF6915
Species: Hu, Mu, Rt
Applications: WB
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-76997
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24713
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
AF5634
Species: Hu
Applications: WB
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89482
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for MTCH2 Antibody (NBP1-89482) (0)

There are no publications for MTCH2 Antibody (NBP1-89482).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTCH2 Antibody (NBP1-89482) (0)

There are no reviews for MTCH2 Antibody (NBP1-89482). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MTCH2 Antibody (NBP1-89482) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTCH2 Products

Bioinformatics Tool for MTCH2 Antibody (NBP1-89482)

Discover related pathways, diseases and genes to MTCH2 Antibody (NBP1-89482). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTCH2 Antibody (NBP1-89482)

Discover more about diseases related to MTCH2 Antibody (NBP1-89482).
 

Pathways for MTCH2 Antibody (NBP1-89482)

View related products by pathway.

PTMs for MTCH2 Antibody (NBP1-89482)

Learn more about PTMs related to MTCH2 Antibody (NBP1-89482).

Blogs on MTCH2

There are no specific blogs for MTCH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTCH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTCH2