KCTD15 Antibody - Azide and BSA Free

Western Blot: KCTD15 Antibody [H00079047-B01P] - Analysis of KCTD15 expression in rat brain.

Immunocytochemistry/Immunofluorescence: KCTD15 Antibody [H00079047-B01P] - Analysis of purified antibody to KCTD15 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: KCTD15 Antibody [H00079047-B01P] - Analysis of KCTD15 expression in transfected 293T cell line by KCTD15 polyclonal antibody. Lane 1: KCTD15 transfected lysate(25.74 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KCTD15 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse KCTD15 Antibody - Azide and BSA Free (H00079047-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-KCTD15 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: KCTD15 (NP_076981.1, 1 a.a. - 234 a.a.) full-length human protein. MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL
• Specificity: Reacts with potassium channel tetramerisation domain containing 15.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: KCTD15
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Western Blot 1:500
• Application Notes: This antibody is reactive against tissue and transfected lysate in western blot, immunofluorescence, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCTD15 Antibody - Azide and BSA Free

• BTB/POZ domain-containing protein KCTD15
• MGC25497
• MGC2628
• potassium channel tetramerisation domain containing 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KCTD15 Antibody (H00079047-B01P)(2)

Publications using H00079047-B01P

• Zarelli VE, Dawid IB. The BTB-containing protein Kctd15 is SUMOylated in vivo. PLoS One. 2013-01-01 [PMID: 24086424]
• Zarelli VE, Dawid IB. Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2. Proc Natl Acad Sci U S A. 2013-02-19 [PMID: 23382213] (Human)

Bioinformatics

• Gene Symbol: KCTD15
• Entrez:
  • 79047(Human)
• Uniprot:
  • NP_076981.1(Human)