AP-2 beta/TFAP2B Antibody

Images

 
Immunohistochemistry-Paraffin: AP-2 beta/TFAP2B Antibody [NBP1-89063] - Staining of human epididymis shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP-2 beta/TFAP2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFAP2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AP-2 beta/TFAP2B Protein (NBP1-89063PEP)
Publications
Read Publication using
NBP1-89063 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP-2 beta/TFAP2B Antibody

  • activating enhancer binding protein 2 beta
  • Activating enhancer-binding protein 2-beta
  • AP2 beta
  • AP-2 beta
  • AP-2B
  • AP2-B
  • AP2-beta
  • CHAR
  • MGC21381
  • TFAP2B
  • transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
  • transcription factor AP-2 beta (activating enhancer-binding protein 2 beta)
  • transcription factor AP-2-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5059
Species: Hu
Applications: WB, IHC
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92090
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5269
Species: Hu, Mu
Applications: WB, IHC
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-24713
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
NBP1-76997
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-76998
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14148
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for AP-2 beta/TFAP2B Antibody (NBP1-89063)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for AP-2 beta/TFAP2B Antibody (NBP1-89063) (0)

There are no reviews for AP-2 beta/TFAP2B Antibody (NBP1-89063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AP-2 beta/TFAP2B Antibody (NBP1-89063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP-2 beta/TFAP2B Products

Bioinformatics Tool for AP-2 beta/TFAP2B Antibody (NBP1-89063)

Discover related pathways, diseases and genes to AP-2 beta/TFAP2B Antibody (NBP1-89063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP-2 beta/TFAP2B Antibody (NBP1-89063)

Discover more about diseases related to AP-2 beta/TFAP2B Antibody (NBP1-89063).
 

Pathways for AP-2 beta/TFAP2B Antibody (NBP1-89063)

View related products by pathway.

PTMs for AP-2 beta/TFAP2B Antibody (NBP1-89063)

Learn more about PTMs related to AP-2 beta/TFAP2B Antibody (NBP1-89063).
 

Research Areas for AP-2 beta/TFAP2B Antibody (NBP1-89063)

Find related products by research area.

Blogs on AP-2 beta/TFAP2B

There are no specific blogs for AP-2 beta/TFAP2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP-2 beta/TFAP2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFAP2B
Entrez