MTCH1 Antibody

Images

 
Immunohistochemistry-Paraffin: MTCH1 Antibody [NBP1-84505] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTCH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLLAHFINAYLVDDSVSDTPGGLGNDQNPGSQFSQALAIRSYTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTCH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MTCH1 Protein (NBP1-84505PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTCH1 Antibody

  • cell proliferation-inducing protein 60
  • CGI-64
  • MGC131998
  • mitochondrial carrier homolog 1 (C. elegans)
  • mitochondrial carrier homolog 1
  • Presenilin-associated protein
  • PSAPPIG60

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA
AF1085
Species: Mu
Applications: WB, IHC, Neut
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP2-45889
Species: Hu
Applications: WB, IHC
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-52884
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MTCH1 Antibody (NBP1-84505) (0)

There are no publications for MTCH1 Antibody (NBP1-84505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTCH1 Antibody (NBP1-84505) (0)

There are no reviews for MTCH1 Antibody (NBP1-84505). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MTCH1 Antibody (NBP1-84505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTCH1 Products

Bioinformatics Tool for MTCH1 Antibody (NBP1-84505)

Discover related pathways, diseases and genes to MTCH1 Antibody (NBP1-84505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTCH1 Antibody (NBP1-84505)

Discover more about diseases related to MTCH1 Antibody (NBP1-84505).
 

Pathways for MTCH1 Antibody (NBP1-84505)

View related products by pathway.

PTMs for MTCH1 Antibody (NBP1-84505)

Learn more about PTMs related to MTCH1 Antibody (NBP1-84505).

Blogs on MTCH1

There are no specific blogs for MTCH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTCH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTCH1