MSPR/Ron Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MSP R/Ron Antibody [NBP1-88136] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: MSP R/Ron Antibody [NBP1-88136] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: MSP R/Ron Antibody [NBP1-88136] - Staining of human vagina shows strong cytoplasmic positivity in squamous epithelial cells.
Independent Antibodies: Immunohistochemistry-Paraffin: MSP R/Ron Antibody [NBP1-88136] - Staining of human cerebral cortex, colon, lymph node and skin using Anti-MST1R antibody NBP1-88136 (A) shows similar ...read more
Immunohistochemistry-Paraffin: MSP R/Ron Antibody [NBP1-88136] - Staining of human colon.
Immunohistochemistry-Paraffin: MSP R/Ron Antibody [NBP1-88136] - Staining of human skin.
Immunohistochemistry-Paraffin: MSP R/Ron Antibody [NBP1-88136] - Staining of human lymph node.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

MSPR/Ron Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MST1R
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MSPR/Ron Recombinant Protein Antigen (NBP1-88136PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MSPR/Ron Antibody

  • CD136 antigen
  • CD136
  • CDw136c-met-related tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.1
  • macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
  • MSP R
  • MSP receptor
  • MSPR
  • MST1R
  • p185-Ron
  • Protein-tyrosine kinase 8
  • PTK8 protein tyrosine kinase 8
  • PTK8
  • Ron
  • RONmacrophage-stimulating protein receptor
  • soluble RON variant 1
  • soluble RON variant 2
  • soluble RON variant 3
  • soluble RON variant 4

Background

Ron, the tyrosine kinase receptor for the Macrophage-stimulating protein, is involved in cell dissociation, motility, and matrix invasion (1). Ron, a cDNA homologous to the hepatocyte growth factor (HGF) receptor gene (MET), encodes a putative tyrosine kinase. It has been shown that the Ron gene is expressed in several epithelial tissues as well as in granulocytes and monocytes. The major RON transcript is translated into a glycosylated single chain precursor, cleaved into a 185 kDa heterodimer (p185Ron) of 35 (alpha) and 150 kDa (beta) disulfide-linked chains, before exposure at the cell surface (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

352-MS/CF
Species: Hu
Applications: BA, BA
294-HG/CF
Species: Hu
Applications: BA
AF276
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, WB
H00084000-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-97644
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB (-), WB
NBP2-38464
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
D6050
Species: Hu
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-88136
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MSPR/Ron Antibody (NBP1-88136) (0)

There are no publications for MSPR/Ron Antibody (NBP1-88136).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSPR/Ron Antibody (NBP1-88136) (0)

There are no reviews for MSPR/Ron Antibody (NBP1-88136). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MSPR/Ron Antibody (NBP1-88136). (Showing 1 - 1 of 1 FAQ).

  1. Would you please help advise the concentration of NBP1-88136? If there is the lot-to-lot difference, may we ask the concentration of the latest lot?
    • I have pulled up the information and the most current lot concentration of this antibody is 0.3 mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional MSPR/Ron Products

Bioinformatics Tool for MSPR/Ron Antibody (NBP1-88136)

Discover related pathways, diseases and genes to MSPR/Ron Antibody (NBP1-88136). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSPR/Ron Antibody (NBP1-88136)

Discover more about diseases related to MSPR/Ron Antibody (NBP1-88136).
 

Pathways for MSPR/Ron Antibody (NBP1-88136)

View related products by pathway.

PTMs for MSPR/Ron Antibody (NBP1-88136)

Learn more about PTMs related to MSPR/Ron Antibody (NBP1-88136).
 

Research Areas for MSPR/Ron Antibody (NBP1-88136)

Find related products by research area.

Blogs on MSPR/Ron

There are no specific blogs for MSPR/Ron, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSPR/Ron Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MST1R