MRS2 Antibody

Images

 
Western Blot: MRS2 Antibody [NBP2-34200] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-358
Immunohistochemistry-Paraffin: MRS2 Antibody [NBP2-34200] - Staining of human stomach shows strong cytoplasmic with additional membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFI
Specificity
Specificity of human MRS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRS2 Protein (NBP2-34200PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRS2 Antibody

  • HPT
  • MGC78523
  • mitochondrial
  • MRS2 magnesium homeostasis factor homolog (S. cerevisiae)
  • MRS2-like protein
  • MRS2-like, magnesium homeostasis factor (S. cerevisiae)
  • MRS2-like, magnesium homeostasis factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35212
Species: Hu
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
6144-GH
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-41273
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl

Publications for MRS2 Antibody (NBP2-34200) (0)

There are no publications for MRS2 Antibody (NBP2-34200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRS2 Antibody (NBP2-34200) (0)

There are no reviews for MRS2 Antibody (NBP2-34200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRS2 Antibody (NBP2-34200). (Showing 1 - 1 of 1 FAQ).

  1. I would like to know, please, if you sell an Mrs2 (Magnesium Transporter) antibody to detect yeast Mrs2. i have seen you have a a couple of them for detection of human Mrs2. As the sequence identity between both species (yeast and human) is low, I am not sure if these antibodies would cross react.
    • Currently we have two antibodies to MRS2. Unfortunately, neither has been tested for cross reaction with the yeast protein. I was also not able to find the yeast sequence to run alignments against our products. If you have this and would like me to run an alignment against our two products, I would be happy to do so. We typically like to see 80+% homology between sequences for ideal cross reaction, but we have seen much lower percentages yield positive results. Since this species would not be covered under our 100% guarantee, we can offer you our Innovators Reward Program if you decide to try one of our products. In exchange for a review of your experiment using one of our products, we would issue you a credit for the purchase price of the antibody for use in a future purchase.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MRS2 Antibody (NBP2-34200)

Discover related pathways, diseases and genes to MRS2 Antibody (NBP2-34200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRS2 Antibody (NBP2-34200)

Discover more about diseases related to MRS2 Antibody (NBP2-34200).
 

Pathways for MRS2 Antibody (NBP2-34200)

View related products by pathway.

PTMs for MRS2 Antibody (NBP2-34200)

Learn more about PTMs related to MRS2 Antibody (NBP2-34200).

Blogs on MRS2

There are no specific blogs for MRS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRS2
Uniprot