MRPS30 Antibody

Images

 
Immunohistochemistry: MRPS30 Antibody [NBP1-87344] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS30 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPS30 Protein (NBP1-87344PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS30 Antibody

  • 28S ribosomal protein S30, mitochondrial
  • DKFZp566B2024
  • mitochondrial ribosomal protein S30
  • MRP-S30
  • PAP
  • PDCD9
  • programmed cell death 9
  • Programmed cell death protein 9
  • S30mt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6240
Species: Hu
Applications: WB, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-87344
Species: Hu
Applications: IHC, IHC-P

Publications for MRPS30 Antibody (NBP1-87344) (0)

There are no publications for MRPS30 Antibody (NBP1-87344).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS30 Antibody (NBP1-87344) (0)

There are no reviews for MRPS30 Antibody (NBP1-87344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPS30 Antibody (NBP1-87344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS30 Products

Bioinformatics Tool for MRPS30 Antibody (NBP1-87344)

Discover related pathways, diseases and genes to MRPS30 Antibody (NBP1-87344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS30 Antibody (NBP1-87344)

Discover more about diseases related to MRPS30 Antibody (NBP1-87344).
 

Pathways for MRPS30 Antibody (NBP1-87344)

View related products by pathway.

Research Areas for MRPS30 Antibody (NBP1-87344)

Find related products by research area.

Blogs on MRPS30

There are no specific blogs for MRPS30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS30