MRP4/ABCC4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MRP4/ABCC4 Antibody [NBP1-84782] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: MRP4/ABCC4 Antibody [NBP1-84782] - Staining of human prostate shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRP4/ABCC4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRP4/ABCC4 Protein (NBP1-84782PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRP4/ABCC4 Antibody

  • ABCC4
  • ATP-binding cassette sub-family C member 4
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 4
  • EST170205
  • MOATB
  • MOAT-BbA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4)
  • MOATBcanalicular multispecific organic anion transporter (ABC superfamily)
  • MRP4
  • MRP4MRP/cMOAT-related ABC transporter
  • multidrug resistance-associated protein 4
  • multispecific organic anion transporter B
  • Multi-specific organic anion transporter B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-94881
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
MAB25031
Species: Hu
Applications: WB, IHC, IP

Publications for MRP4/ABCC4 Antibody (NBP1-84782) (0)

There are no publications for MRP4/ABCC4 Antibody (NBP1-84782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRP4/ABCC4 Antibody (NBP1-84782) (0)

There are no reviews for MRP4/ABCC4 Antibody (NBP1-84782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MRP4/ABCC4 Antibody (NBP1-84782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRP4/ABCC4 Products

Bioinformatics Tool for MRP4/ABCC4 Antibody (NBP1-84782)

Discover related pathways, diseases and genes to MRP4/ABCC4 Antibody (NBP1-84782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRP4/ABCC4 Antibody (NBP1-84782)

Discover more about diseases related to MRP4/ABCC4 Antibody (NBP1-84782).
 

Pathways for MRP4/ABCC4 Antibody (NBP1-84782)

View related products by pathway.

PTMs for MRP4/ABCC4 Antibody (NBP1-84782)

Learn more about PTMs related to MRP4/ABCC4 Antibody (NBP1-84782).
 

Research Areas for MRP4/ABCC4 Antibody (NBP1-84782)

Find related products by research area.

Blogs on MRP4/ABCC4

There are no specific blogs for MRP4/ABCC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRP4/ABCC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC4
Entrez