MRFAP1 Antibody - BSA Free

Western Blot: MRFAP1 Antibody [NBP1-98552] - Antibody Dilution: 1.0ug/ml Sample Tissue: Jurkat cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MRFAP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is MRFAP1 - N-terminal region. Peptide sequence PVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQVEASEESAL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRFAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 15 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MRFAP1 Antibody - BSA Free

• Mof4 family associated protein 1
• Morf4 family associated protein 1
• PAM14MORF4 family-associated protein 1
• PGR1protein associated with MRG, 14 kDa
• Protein associated with MRG of 14 kDa
• Protein PGR1
• T-cell activation protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRFAP1
• Uniprot:
  • NP_150638(Human)