MRFAP1 Antibody

Images

 
Western Blot: MRFAP1 Antibody [NBP1-98552] - Antibody Dilution: 1.0ug/ml Sample Tissue: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

MRFAP1 Antibody Summary

Immunogen
The immunogen for this antibody is MRFAP1 - N-terminal region. Peptide sequence PVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQVEASEESAL.
Clonality
Polyclonal
Host
Rabbit
Gene
MRFAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MRFAP1 Antibody

  • Mof4 family associated protein 1
  • Morf4 family associated protein 1
  • PAM14MORF4 family-associated protein 1
  • PGR1protein associated with MRG, 14 kDa
  • Protein associated with MRG of 14 kDa
  • Protein PGR1
  • T-cell activation protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

49130002
Species: Ce
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB120-2765
Species: Hu, Mu, Rt, Bv, Ch, GP, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33930
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84936
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006399-M01
Species: Hu
Applications: WB, ELISA
NB120-3077
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP1-85157
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF262
Species: Hu
Applications: WB, IHC, ICC, Neut
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MRFAP1 Antibody (NBP1-98552) (0)

There are no publications for MRFAP1 Antibody (NBP1-98552).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRFAP1 Antibody (NBP1-98552) (0)

There are no reviews for MRFAP1 Antibody (NBP1-98552). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRFAP1 Antibody (NBP1-98552) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRFAP1 Antibody Products

MRFAP1 NBP1-98552

Related Products by Gene

Bioinformatics Tool for MRFAP1 Antibody (NBP1-98552)

Discover related pathways, diseases and genes to MRFAP1 Antibody (NBP1-98552). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRFAP1 Antibody (NBP1-98552)

Discover more about diseases related to MRFAP1 Antibody (NBP1-98552).
 

Pathways for MRFAP1 Antibody (NBP1-98552)

View related products by pathway.

PTMs for MRFAP1 Antibody (NBP1-98552)

Learn more about PTMs related to MRFAP1 Antibody (NBP1-98552).

Blogs on MRFAP1

There are no specific blogs for MRFAP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MRFAP1
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98552 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought