MRFAP1 Antibody (NBP1-98552)

Images

 
Western Blot: MRFAP1 Antibody [NBP1-98552] - Antibody Dilution: 1.0ug/ml Sample Tissue: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRFAP1 Antibody Summary

Immunogen
The immunogen for this antibody is MRFAP1 - N-terminal region. Peptide sequence PVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQVEASEESAL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRFAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MRFAP1 Antibody

  • Mof4 family associated protein 1
  • Morf4 family associated protein 1
  • PAM14MORF4 family-associated protein 1
  • PGR1protein associated with MRG, 14 kDa
  • Protein associated with MRG of 14 kDa
  • Protein PGR1
  • T-cell activation protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

49130002
Species: Ce
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-33930
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84936
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56481
Species: Hu
Applications: ICC/IF
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3166
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85157
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-98552
Species: Hu
Applications: WB

Publications for MRFAP1 Antibody (NBP1-98552) (0)

There are no publications for MRFAP1 Antibody (NBP1-98552).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRFAP1 Antibody (NBP1-98552) (0)

There are no reviews for MRFAP1 Antibody (NBP1-98552). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRFAP1 Antibody (NBP1-98552) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRFAP1 Products

Related Products by Gene

Bioinformatics Tool for MRFAP1 Antibody (NBP1-98552)

Discover related pathways, diseases and genes to MRFAP1 Antibody (NBP1-98552). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRFAP1 Antibody (NBP1-98552)

Discover more about diseases related to MRFAP1 Antibody (NBP1-98552).
 

Pathways for MRFAP1 Antibody (NBP1-98552)

View related products by pathway.

PTMs for MRFAP1 Antibody (NBP1-98552)

Learn more about PTMs related to MRFAP1 Antibody (NBP1-98552).

Blogs on MRFAP1

There are no specific blogs for MRFAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRFAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRFAP1
Uniprot