MRG-binding protein Antibody

Images

 
Western Blot: MRG-binding protein Antibody [NBP1-84936] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-352
Immunocytochemistry/ Immunofluorescence: MRG-binding protein Antibody [NBP1-84936] - Staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining in human testis and endometrium tissues using anti-MRGBP antibody. Corresponding MRGBP RNA-seq data are presented for the same tissues.
Western Blot: MRG-binding protein Antibody [NBP1-84936] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: MRG-binding protein Antibody [NBP1-84936] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRG-binding protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKE
Specificity
Specificity of human, mouse, rat MRG-binding protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRGBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRG-binding protein Protein (NBP1-84936PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRG-binding protein Antibody

  • chromosome 20 open reading frame 20
  • Eaf7
  • FLJ10914
  • MRG(MORF4-related gene)-binding protein
  • MRG15BP
  • MRG-binding protein
  • MRGBPURCC4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

49130002
Species: Ce
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-65898
Species: Hu
NBP1-45244
Species: Hu, Mu, Rt, Ca
Applications: WB, PEP-ELISA
NBP2-03982
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00008294-P01
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
H00085403-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86099
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16609
Species: Hu
Applications: WB, ICC/IF
NBP1-84936
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MRG-binding protein Antibody (NBP1-84936) (0)

There are no publications for MRG-binding protein Antibody (NBP1-84936).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRG-binding protein Antibody (NBP1-84936) (0)

There are no reviews for MRG-binding protein Antibody (NBP1-84936). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRG-binding protein Antibody (NBP1-84936) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRG-binding protein Products

Bioinformatics Tool for MRG-binding protein Antibody (NBP1-84936)

Discover related pathways, diseases and genes to MRG-binding protein Antibody (NBP1-84936). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRG-binding protein Antibody (NBP1-84936)

Discover more about diseases related to MRG-binding protein Antibody (NBP1-84936).
 

Pathways for MRG-binding protein Antibody (NBP1-84936)

View related products by pathway.

PTMs for MRG-binding protein Antibody (NBP1-84936)

Learn more about PTMs related to MRG-binding protein Antibody (NBP1-84936).
 

Research Areas for MRG-binding protein Antibody (NBP1-84936)

Find related products by research area.

Blogs on MRG-binding protein

There are no specific blogs for MRG-binding protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRG-binding protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRGBP