MPRA Antibody


Immunocytochemistry/ Immunofluorescence: MPRA Antibody [NBP2-13731] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MPRA Antibody [NBP2-13731] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules and cells in glomeruli.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

MPRA Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAG YRPLHQTWRFYFRTLFQQHNEA
Specificity of human MPRA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MPRA Protein (NBP2-13731PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MPRA Antibody

  • membrane progestin receptor alpha
  • mPR alpha
  • MPRA2310021M12Rik
  • MRPA
  • mSR
  • Progestin and adipoQ receptor family member 7
  • progestin and adipoQ receptor family member VIIPGLP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PLA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Eq, Ha
Applications: WB (-), IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, KD, KO
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IF

Publications for MPRA Antibody (NBP2-13731) (0)

There are no publications for MPRA Antibody (NBP2-13731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPRA Antibody (NBP2-13731) (0)

There are no reviews for MPRA Antibody (NBP2-13731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MPRA Antibody (NBP2-13731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MPRA Products

Bioinformatics Tool for MPRA Antibody (NBP2-13731)

Discover related pathways, diseases and genes to MPRA Antibody (NBP2-13731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPRA Antibody (NBP2-13731)

Discover more about diseases related to MPRA Antibody (NBP2-13731).

Pathways for MPRA Antibody (NBP2-13731)

View related products by pathway.

PTMs for MPRA Antibody (NBP2-13731)

Learn more about PTMs related to MPRA Antibody (NBP2-13731).

Blogs on MPRA

There are no specific blogs for MPRA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MPRA Antibody and receive a gift card or discount.


Gene Symbol PAQR7