Methionine Sulfoxide Reductase A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Immunofluorescence analysis of NIH/3T3 cells using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Western blot analysis of various lysates using Methionine Sulfoxide Reductase A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Immunofluorescence analysis of PC-12 cells using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-38255] - Immunofluorescence analysis of U2OS cells using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Methionine Sulfoxide Reductase A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Methionine Sulfoxide Reductase A Antibody - BSA Free (NBP3-38255) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-235 of human Methionine Sulfoxide Reductase A (NP_036463.1).
  
  Sequence:
  GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSRA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Methionine Sulfoxide Reductase A Antibody - BSA Free

• cytosolic methionine-S-sulfoxide reductase
• EC 1.8.4.11
• methionine sulfoxide reductase A
• peptide met (O) reductase
• Peptide Met(O) reductase
• peptide methionine sulfoxide reductase
• Peptide-methionine (S)-S-oxide reductase
• PMSR
• Protein-methionine-S-oxide reductase

Background

This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MSRA