| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to MAOB(monoamine oxidase B) The peptide sequence was selected from the N terminal of MAOB. Peptide sequence RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV. The peptide sequence for this immunogen was taken from within the described region. |
| Marker | Mitochondrial Outer Membrane Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MAOB |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Monoamine Oxidase B Antibody validated for Simple Western from a verified customer review. See Simple Western Antibody Database for Simple Western validation |
|
| Theoretical MW | 59 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP1-59569 | Applications | Species |
|---|---|---|
| Liu CH, Ren J, Liu PK. Amphetamine manipulates monoamine oxidase-A level and behavior using theranostic aptamers of transcription factors AP-1/NF-kB J. Biomed. Sci. 2016-02-04 [PMID: 26841904] (WB, Mouse) | WB | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Stella Dracheva |
Simple Western | Human | 04/06/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Monoamine Oxidase B Antibody (NBP1-59569)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Stella Dracheva 04/06/2023 |
||
| Application: | Simple Western | |
| Species: | Human |