VAP-1/AOC3 Antibody

Images

 
Western Blot: VAP-1/AOC3 Antibody [NBP1-89671] - Analysis in control (vector only transfected HEK293T lysate) and aOC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Staining of human rectum shows distinct positivity in endothelial cells and smooth muscle.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VAP-1/AOC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AOC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VAP-1/AOC3 Protein (NBP1-89671PEP)
Publications
Read Publications using
NBP1-89671 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%). Human reactivity reported in scientific literature (PMID: 25562318).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VAP-1/AOC3 Antibody

  • amine oxidase, copper containing 3 (vascular adhesion protein 1)
  • AOC3
  • Copper amine oxidase
  • EC 1.4.3
  • HPAO
  • HPAOSSAO
  • Semicarbazide-sensitive amine oxidase
  • SSAO
  • VAP1
  • VAP-1
  • VAP1EC 1.4.3.21
  • VAP-1membrane primary amine oxidase
  • Vascular adhesion protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
796-IC
Species: Mu
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-62442
Species: Hu
Applications: WB
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA

Publications for VAP-1/AOC3 Antibody (NBP1-89671)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for VAP-1/AOC3 Antibody (NBP1-89671) (0)

There are no reviews for VAP-1/AOC3 Antibody (NBP1-89671). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VAP-1/AOC3 Antibody (NBP1-89671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VAP-1/AOC3 Products

Bioinformatics Tool for VAP-1/AOC3 Antibody (NBP1-89671)

Discover related pathways, diseases and genes to VAP-1/AOC3 Antibody (NBP1-89671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAP-1/AOC3 Antibody (NBP1-89671)

Discover more about diseases related to VAP-1/AOC3 Antibody (NBP1-89671).
 

Pathways for VAP-1/AOC3 Antibody (NBP1-89671)

View related products by pathway.

PTMs for VAP-1/AOC3 Antibody (NBP1-89671)

Learn more about PTMs related to VAP-1/AOC3 Antibody (NBP1-89671).

Blogs on VAP-1/AOC3

There are no specific blogs for VAP-1/AOC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VAP-1/AOC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AOC3
Entrez