VAP-1/AOC3 Antibody

Images

 
Western Blot: VAP-1/AOC3 Antibody [NBP1-89671] - Analysis in control (vector only transfected HEK293T lysate) and aOC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Equine endometrium. All vascular smooth muscle was positively stained. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Staining of human lung shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Analysis in human lung and skeletal muscle tissues. Corresponding AOC3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Staining of human prostate shows moderate membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: VAP-1/AOC3 Antibody [NBP1-89671] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Product Details

Summary
Reactivity Hu, EqSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

VAP-1/AOC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI
Specificity
Specificity of human VAP-1/AOC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AOC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VAP-1/AOC3 Protein (NBP1-89671PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89671 in the following applications:

Publications
Read Publications using
NBP1-89671 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%). Human reactivity reported in scientific literature (PMID: 25562318). Equine reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VAP-1/AOC3 Antibody

  • amine oxidase, copper containing 3 (vascular adhesion protein 1)
  • AOC3
  • Copper amine oxidase
  • EC 1.4.3
  • HPAO
  • HPAOSSAO
  • Semicarbazide-sensitive amine oxidase
  • SSAO
  • VAP1
  • VAP-1
  • VAP1EC 1.4.3.21
  • VAP-1membrane primary amine oxidase
  • Vascular adhesion protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2527
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
796-IC
Species: Mu
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
BBA16
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
H00000314-P01
Species: Hu
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF

Publications for VAP-1/AOC3 Antibody (NBP1-89671)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for VAP-1/AOC3 Antibody (NBP1-89671) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Equine.

Reviews using NBP1-89671:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Equine
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin VAP-1/AOC3 NBP1-89671
Enlarge
reviewed by:
Anonymous
IHC-P Equine 02/20/2020
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedEndometrium
SpeciesEquine
LotC117560

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VAP-1/AOC3 Antibody (NBP1-89671) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VAP-1/AOC3 Products

Bioinformatics Tool for VAP-1/AOC3 Antibody (NBP1-89671)

Discover related pathways, diseases and genes to VAP-1/AOC3 Antibody (NBP1-89671). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAP-1/AOC3 Antibody (NBP1-89671)

Discover more about diseases related to VAP-1/AOC3 Antibody (NBP1-89671).
 

Pathways for VAP-1/AOC3 Antibody (NBP1-89671)

View related products by pathway.

PTMs for VAP-1/AOC3 Antibody (NBP1-89671)

Learn more about PTMs related to VAP-1/AOC3 Antibody (NBP1-89671).

Blogs on VAP-1/AOC3

There are no specific blogs for VAP-1/AOC3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
02/20/2020
Application: IHC-P
Species: Equine

Bioinformatics

Gene Symbol AOC3