MNDA Antibody

Images

 
Western Blot: MNDA Antibody [NBP1-87180] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: MNDA Antibody [NBP1-87180] - Staining of human bone marrow shows strong nuclear positivity in subsets of hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MNDA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PQTSSSTPSNTSFTPNQETQAQRQVDARRNVPQNDPVTVVVLKATAPFKYESPENGKSTMFHATVASKTQYFHVKVFDINLKEKFVRKKVITISDYSECKGVMEIKEASSVSDFN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MNDA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MNDA Protein (NBP1-87180PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MNDA Antibody

  • myeloid cell nuclear differentiation antigen
  • PYHIN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83118
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00009447-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-13835
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NBP2-27066
Species: Mu
Applications: WB
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP2-27153
Species: Mu
Applications: WB, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87180
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MNDA Antibody (NBP1-87180) (0)

There are no publications for MNDA Antibody (NBP1-87180).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MNDA Antibody (NBP1-87180) (0)

There are no reviews for MNDA Antibody (NBP1-87180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MNDA Antibody (NBP1-87180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MNDA Products

Bioinformatics Tool for MNDA Antibody (NBP1-87180)

Discover related pathways, diseases and genes to MNDA Antibody (NBP1-87180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MNDA Antibody (NBP1-87180)

Discover more about diseases related to MNDA Antibody (NBP1-87180).
 

Pathways for MNDA Antibody (NBP1-87180)

View related products by pathway.

PTMs for MNDA Antibody (NBP1-87180)

Learn more about PTMs related to MNDA Antibody (NBP1-87180).

Blogs on MNDA

There are no specific blogs for MNDA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MNDA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MNDA