PYHIN1 Antibody

Images

 
Western Blot: PYHIN1 Antibody [NBP2-13835] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human tonsil shows moderate nuclear positivity in both germinal center cells and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PYHIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKP SEEETGTKRSKMSKEQTRPSCS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PYHIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PYHIN1 Protein (NBP2-13835PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PYHIN1 Antibody

  • IFIXMGC23885
  • Interferon-inducible protein X
  • pyrin and HIN domain family, member 1
  • pyrin and HIN domain-containing protein 1
  • RP11-520H16.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83118
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009447-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45907
Species: Hu
Applications: WB, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27066
Species: Mu
Applications: WB
NBP2-27153
Species: Mu
Applications: WB, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
AF6897
Species: Hu, Mu
Applications: WB, IHC

Publications for PYHIN1 Antibody (NBP2-13835) (0)

There are no publications for PYHIN1 Antibody (NBP2-13835).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PYHIN1 Antibody (NBP2-13835) (0)

There are no reviews for PYHIN1 Antibody (NBP2-13835). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PYHIN1 Antibody (NBP2-13835) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PYHIN1 Products

Bioinformatics Tool for PYHIN1 Antibody (NBP2-13835)

Discover related pathways, diseases and genes to PYHIN1 Antibody (NBP2-13835). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PYHIN1 Antibody (NBP2-13835)

Discover more about diseases related to PYHIN1 Antibody (NBP2-13835).
 

Pathways for PYHIN1 Antibody (NBP2-13835)

View related products by pathway.

Blogs on PYHIN1

There are no specific blogs for PYHIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PYHIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PYHIN1