![Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining in human tonsil and liver tissues using NBP2-13835 antibody. Corresponding PYHIN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PYHIN1-Antibody-Immunohistochemistry-Paraffin-NBP2-13835-img0012.jpg "Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining in human tonsil and liver tissues using NBP2-13835 antibody. Corresponding PYHIN1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PYHIN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PYHIN1 |
![Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PYHIN1-Antibody-Immunohistochemistry-Paraffin-NBP2-13835-img0008.jpg "Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human rectum shows moderate cytoplasmic/ nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/PYHIN1-Antibody-Immunohistochemistry-Paraffin-NBP2-13835-img0009.jpg "Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human rectum shows moderate cytoplasmic/ nuclear positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human testis shows weak nuclear positivity in a small subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PYHIN1-Antibody-Immunohistochemistry-Paraffin-NBP2-13835-img0010.jpg "Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human testis shows weak nuclear positivity in a small subset of cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/PYHIN1-Antibody-Immunohistochemistry-Paraffin-NBP2-13835-img0011.jpg "Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.")
![Western Blot Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Western_Blot_15557.jpg)
![Simple Western Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Simple_Western_17977.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")