PYHIN1 Antibody

Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining in human tonsil and liver tissues using NBP2-13835 antibody. Corresponding PYHIN1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human rectum shows moderate cytoplasmic/ nuclear positivity in lymphoid cells.

Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human testis shows weak nuclear positivity in a small subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PYHIN1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PYHIN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PYHIN1 Protein (NBP2-13835PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PYHIN1 Antibody

• IFIXMGC23885
• Interferon-inducible protein X
• pyrin and HIN domain family, member 1
• pyrin and HIN domain-containing protein 1
• RP11-520H16.1

Background

PYHIN1 belongs to the HIN200 family of interferon-inducible proteins that share a 200-amino acid signature motif attheir C-terminal ends. HIN200 proteins are primarily nuclear and are involved in transcriptional regulation of genesimportant for cell cycle control, differentiation, and apoptosis (Ding et al., 2006 (PubMed 16479015)).(supplied byOMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PYHIN1