PYHIN1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: IESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PYHIN1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PYHIN1 Antibody
Background
PYHIN1 belongs to the HIN200 family of interferon-inducible proteins that share a 200-amino acid signature motif attheir C-terminal ends. HIN200 proteins are primarily nuclear and are involved in transcriptional regulation of genesimportant for cell cycle control, differentiation, and apoptosis (Ding et al., 2006 (PubMed 16479015)).(supplied byOMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: IHC, WB
Publications for PYHIN1 Antibody (NBP2-13835) (0)
There are no publications for PYHIN1 Antibody (NBP2-13835).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PYHIN1 Antibody (NBP2-13835) (0)
There are no reviews for PYHIN1 Antibody (NBP2-13835).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PYHIN1 Antibody (NBP2-13835) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PYHIN1 Products
Diseases for PYHIN1 Antibody (NBP2-13835)
Discover more about diseases related to PYHIN1 Antibody (NBP2-13835).
| | Pathways for PYHIN1 Antibody (NBP2-13835)
View related products by pathway.
|
Blogs on PYHIN1