IFI16 Antibody - BSA Free

Immunohistochemistry: IFI16 Antibody [NBP1-83118] - Induced expression of NOD2, CARD6, PYCARD, and IFI16 in psoriasis lesions. Immunohistochemistry shows stronger NOD2, CARD6, PYCARD, and IFI16 staining in PL (upper) than in controls (lower). PN (middle) and C are almost negative for NOD2 and CARD6. IFI16 is predominantly in nuclei of PL and PN. In controls IFI16 expression is weak and cytoplasmic. PYCARD is strongly induced in cytoplasm but also some nuclei are positive in PL and PN. Controls exhibit only a few PYCARD positive nuclei. Scale bar 50 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep22745) licensed under a CC-BY license.

Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining in human lymph node and skeletal muscle tissues using NBP1-83118 antibody. Corresponding IFI16 RNA-seq data are presented for the same tissues.

Western Blot: IFI16 Antibody [NBP1-83118] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-IFI16 antibody. Corresponding IFI16 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: IFI16 Antibody [NBP1-83118] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Induced expression of NOD2, CARD6, PYCARD, & IFI16 in psoriasis lesions.(a) Immunohistochemistry shows stronger NOD2, CARD6, PYCARD, & IFI16 staining in PL (upper) than in controls (lower). PN (middle) & C are almost negative for NOD2 & CARD6. IFI16 is predominantly in nuclei of PL & PN. In controls IFI16 expression is weak & cytoplasmic. PYCARD is strongly induced in cytoplasm but also some nuclei are positive in PL & PN. Controls exhibit only a few PYCARD positive nuclei. Scale bar 50 μm. (b) IEM of PL shows PYCARD clusters in cytoplasm. (c) Immunofluorescence of keratinocytes colocalizes CARD6 with a mitochondrial MTCO2. (d) IEM of psoriatioc lesional samples also localized CARD6 in the mitochondria (arrow head). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26976200), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IFI16 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFI16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IFI16 Protein (NBP1-83118PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IFI16 Antibody - BSA Free

• ifi-16
• IFNGIP1gamma-interferon-inducible protein 16
• interferon, gamma-inducible protein 16
• interferon-gamma induced protein IFI 16
• Interferon-inducible myeloid differentiation transcriptional activator
• MGC9466
• PYHIN2

Background

IFI16 encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IFI16 Antibody (NBP1-83118)(3)

Publications using NBP1-83118

• Karvas, RM;Zemke, JE;Ali, SS;Upton, E;Sane, E;Fischer, LA;Dong, C;Park, KM;Wang, F;Park, K;Hao, S;Chew, B;Meyer, B;Zhou, C;Dietmann, S;Theunissen, TW; 3D-cultured blastoids model human embryogenesis from pre-implantation to early gastrulation stages Cell stem cell 2023-09-07 [PMID: 37683602]
• D Meisterman, A Bruneau, S Loubersac, A Reignier, J Firmin, V François-C, S Kilens, Y Lelièvre, J Lammers, M Feyeux, P Hulin, S Nedellec, B Bretin, G Castel, N Allègre, S Covin, A Bihouée, M Soumillon, T Mikkelsen, P Barrière, C Chazaud, J Chappell, V Pasque, J Bourdon, T Fréour, L David Integrated pseudotime analysis of human pre-implantation embryo single-cell transcriptomes reveals the dynamics of lineage specification Cell Stem Cell, 2021-05-17;0(0):. 2021-05-17 [PMID: 34004179]
• Tervaniemi MH, Katayama S, Skoog T et al. NOD-like receptor signaling and inflammasome-related pathways are highlighted in psoriatic epidermis. Sci Rep. 2016-03-15 [PMID: 26976200] (IHC-P, Human)
  
  Details:
  HDAC1 antibody was used for WB analysis of abdominal aorta samples from control subjects and the patients undergoing abdominal aortic aneurysms /AAA.

Bioinformatics

• Gene Symbol: IFI16