IFI16 Antibody

Images

 
Immunohistochemistry: IFI16 Antibody [NBP1-83118] - Induced expression of NOD2, CARD6, PYCARD, and IFI16 in psoriasis lesions. Immunohistochemistry shows stronger NOD2, CARD6, PYCARD, and IFI16 staining in PL (upper) ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining in human lymph node and skeletal muscle tissues using NBP1-83118 antibody. Corresponding IFI16 RNA-seq data are ...read more
Orthogonal Strategies: Western Blot: IFI16 Antibody [NBP1-83118] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-IFI16 antibody. Corresponding IFI16 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: IFI16 Antibody [NBP1-83118] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: IFI16 Antibody [NBP1-83118] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

IFI16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFI16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
IHC-P reported in scientific literature (PMID: 26976200). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IFI16 Protein (NBP1-83118PEP)
Publications
Read Publication using
NBP1-83118 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFI16 Antibody

  • ifi-16
  • IFNGIP1gamma-interferon-inducible protein 16
  • interferon, gamma-inducible protein 16
  • interferon-gamma induced protein IFI 16
  • Interferon-inducible myeloid differentiation transcriptional activator
  • MGC9466
  • PYHIN2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27354
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45907
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27153
Species: Mu
Applications: WB, IHC, IHC-P
NB100-304
Species: Hu, Mu, Rt, Bt, Bv, Ca, Fi, Gt, Pm
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, Flow-IC, KD, KO
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-20127
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13835
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-27066
Species: Hu, Mu
Applications: WB
AF4377
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NB600-335
Species: All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83118
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IFI16 Antibody (NBP1-83118)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for IFI16 Antibody (NBP1-83118) (0)

There are no reviews for IFI16 Antibody (NBP1-83118). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IFI16 Antibody (NBP1-83118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IFI16 Products

Bioinformatics Tool for IFI16 Antibody (NBP1-83118)

Discover related pathways, diseases and genes to IFI16 Antibody (NBP1-83118). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI16 Antibody (NBP1-83118)

Discover more about diseases related to IFI16 Antibody (NBP1-83118).
 

Pathways for IFI16 Antibody (NBP1-83118)

View related products by pathway.

PTMs for IFI16 Antibody (NBP1-83118)

Learn more about PTMs related to IFI16 Antibody (NBP1-83118).
 

Research Areas for IFI16 Antibody (NBP1-83118)

Find related products by research area.

Blogs on IFI16.

Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFI16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFI16