MLC1 Antibody

Images

 
Western Blot: MLC1 Antibody [NBP1-81555] - Analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining in human cerebral cortex and pancreas tissues using anti-MLC1 antibody. Corresponding MLC1 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MLC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHK
Specificity
Specificity of human MLC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-81555.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19931615)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MLC1 Antibody

  • LVM
  • megalencephalic leukoencephalopathy with subcortical cysts 1
  • WKL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB7276
Species: Ch
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-62682
Species: Hu
Applications: IHC, IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00085366-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi
NBP2-59947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
MAB4470
Species: Multi
Applications: WB, IHC, ICC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for MLC1 Antibody (NBP1-81555)(1)

Reviews for MLC1 Antibody (NBP1-81555) (0)

There are no reviews for MLC1 Antibody (NBP1-81555). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLC1 Antibody (NBP1-81555) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MLC1 Products

Bioinformatics Tool for MLC1 Antibody (NBP1-81555)

Discover related pathways, diseases and genes to MLC1 Antibody (NBP1-81555). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLC1 Antibody (NBP1-81555)

Discover more about diseases related to MLC1 Antibody (NBP1-81555).
 

Pathways for MLC1 Antibody (NBP1-81555)

View related products by pathway.

PTMs for MLC1 Antibody (NBP1-81555)

Learn more about PTMs related to MLC1 Antibody (NBP1-81555).

Blogs on MLC1

There are no specific blogs for MLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLC1