MLC1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Analysis in human cerebral cortex and pancreas tissues using NBP1-81555 antibody. Corresponding MLC1 RNA-seq data are presented ...read more
Western Blot: MLC1 Antibody [NBP1-81555] - Analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebellum shows moderate cytoplasmic positivity in neuropil of the molecular layer.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MLC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MLC1 Protein (NBP1-81555PEP)
Publications
Read Publications using NBP1-81555.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MLC1 Antibody

  • LVM
  • megalencephalic leukoencephalopathy with subcortical cysts 1
  • WKL1

Background

The function of this gene product is unknown; however, homology to other proteins suggests that it may be an integral membrane transporter. Mutations in this gene have been associated with megalencephalic leukoencephalopathy with subcortical cysts, an autosomal recessive neurological disorder. Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MLC1 Antibody (NBP1-81555)(2)

Reviews for MLC1 Antibody (NBP1-81555) (0)

There are no reviews for MLC1 Antibody (NBP1-81555). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLC1 Antibody (NBP1-81555) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLC1 Products

Research Areas for MLC1 Antibody (NBP1-81555)

Find related products by research area.

Blogs on MLC1

There are no specific blogs for MLC1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLC1