MYLK3 Antibody


Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human heart muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Analysis in human heart muscle and pancreas tissues using Anti-MYLK3 antibody. Corresponding MYLK3 RNA-seq data are presented more
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

MYLK3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHLPLPTKVEAK
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MYLK3 Recombinant Protein Antigen (NBP2-62682PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for MYLK3 Antibody

  • caMLCK
  • Cardiac-MyBP-C-associated Ca/CaM kinase
  • EC 2.7.11
  • EC
  • MGC126319
  • MGC126320
  • MLC kinase
  • MLCK2
  • MLCKcardiac-MyBP-C associated Ca/CaM kinase
  • myosin light chain kinase 3
  • putative myosin light chain kinase 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: All-Multi
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P

Publications for MYLK3 Antibody (NBP2-62682) (0)

There are no publications for MYLK3 Antibody (NBP2-62682).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYLK3 Antibody (NBP2-62682) (0)

There are no reviews for MYLK3 Antibody (NBP2-62682). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MYLK3 Antibody (NBP2-62682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MYLK3 Products

Bioinformatics Tool for MYLK3 Antibody (NBP2-62682)

Discover related pathways, diseases and genes to MYLK3 Antibody (NBP2-62682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYLK3 Antibody (NBP2-62682)

Discover more about diseases related to MYLK3 Antibody (NBP2-62682).

PTMs for MYLK3 Antibody (NBP2-62682)

Learn more about PTMs related to MYLK3 Antibody (NBP2-62682).

Blogs on MYLK3

There are no specific blogs for MYLK3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MYLK3 Antibody and receive a gift card or discount.


Gene Symbol MYLK3