MYLK2 Antibody (2G1)

Images

 
Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - The antibody was tested in mouse skeletal muscle and shows a band below 75 kDa. This image was submitted via customer Review. *{Mouse WB}*
Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - Analysis of MYLK2 over-expressed 293 cell line, cotransfected with MYLK2 Validated Chimera RNAi ( Cat # H00085366-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - Analysis of MYLK2 expression in transfected 293T cell line by MYLK2 monoclonal antibody (M01), clone 2G1.Lane 1: MYLK2 transfected lysate(64.7 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
2G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MYLK2 Antibody (2G1) Summary

Immunogen
MYLK2 (NP_149109, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag.KLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAE SQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQAL CLTAREEDCFQILDDC
Localization
Cytoplasmic
Specificity
MYLK2 - myosin light chain kinase 2, skeletal muscle
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MYLK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It has also been used for RNAi validation.
Reviewed Applications
Read 1 Review rated 5
using
H00085366-M01 in the following applications:

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MYLK2 Antibody (2G1)

  • EC 2.7.11
  • EC 2.7.11.18
  • KMLC
  • MLCK2MLCK
  • myosin light chain kinase 2
  • myosin light chain kinase 2, skeletal/cardiac muscle
  • skeletal muscle
  • skMLCK

Background

This gene encodes a myosin light chain kinase, a calcium/calmodulin dependent enzyme, that is exclusively expressed in adult skeletal muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67486
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu, Rt, Po
Applications: WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-81555
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
MAB4470
Species: Multi
Applications: WB, IHC, ICC
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-62682
Species: Hu
Applications: IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1687
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready

Publications for MYLK2 Antibody (H00085366-M01) (0)

There are no publications for MYLK2 Antibody (H00085366-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MYLK2 Antibody (H00085366-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00085366-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MYLK2 H00085366-M01
Enlarge
reviewed by:
Anonymous
WB Mouse 05/31/2017
View

Summary

ApplicationWestern Blot
Sample TestedMouse skeletal muscle
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYLK2 Antibody (H00085366-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MYLK2 Products

Bioinformatics Tool for MYLK2 Antibody (H00085366-M01)

Discover related pathways, diseases and genes to MYLK2 Antibody (H00085366-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYLK2 Antibody (H00085366-M01)

Discover more about diseases related to MYLK2 Antibody (H00085366-M01).
 

Pathways for MYLK2 Antibody (H00085366-M01)

View related products by pathway.

PTMs for MYLK2 Antibody (H00085366-M01)

Learn more about PTMs related to MYLK2 Antibody (H00085366-M01).
 

Research Areas for MYLK2 Antibody (H00085366-M01)

Find related products by research area.

Blogs on MYLK2

There are no specific blogs for MYLK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
05/31/2017
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol MYLK2
Entrez
OMIM
Uniprot