![Western Blot: Mkl1 Antibody [NBP1-80259] - Sample Tissue: Mouse Spleen Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/Mkl1-Antibody-Western-Blot-NBP1-80259-img0004.jpg "Western Blot: Mkl1 Antibody [NBP1-80259] - Sample Tissue: Mouse Spleen Antibody Dilution: 1.0ug/ml")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse. Peptide sequence QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MRTFA |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Mkl1 Antibody (NBP1-80259)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Mkl1 Antibody [NBP1-80259] - Titration: 1.25ug/ml, Positive Control: NIH/3T3 cell lysate.](http://images.novusbio.com/fullsize/Mkl1-Antibody-Western-Blot-NBP1-80259-img0003.jpg "Western Blot: Mkl1 Antibody [NBP1-80259] - Titration: 1.25ug/ml, Positive Control: NIH/3T3 cell lysate.")
![Western Blot Myocardin Antibody (355521) [Unconjugated]](https://images.novusbio.com/images2/Myocardin_MAB4028_Western_Blot_6147.jpg)
![Western Blot Myocardin Antibody (355521) [Unconjugated]](https://images.novusbio.com/images/mab4028_human-mouse-myocardin-mab-clone-355521-412024125217.jpg)
![Western Blot Myocardin Antibody (355521) [Unconjugated]](https://images.novusbio.com/images/mab4028_human-mouse-myocardin-mab-clone-355521-41202412505317.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry DNER Antibody [Unconjugated]](https://images.novusbio.com/images2/DNER_AF2254_Immunohistochemistry_18506.jpg)
![Immunocytochemistry/ Immunofluorescence DNER Antibody [Unconjugated]](https://images.novusbio.com/images/af2254_mouse-dner-affinity-purified-polyclonal-ab-41202412394943.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")