MIXL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MIXL1 Antibody [NBP2-55175] - Staining of human cell line Hep G2 shows localization to nucleus. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MIXL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSA
Specificity
Specificity of human MIXL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIXL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MIXL1 Antibody

  • hMix
  • homeobox protein MIXL1
  • Homeodomain protein MIX
  • MGC138179
  • MILD1
  • Mix.1 homeobox-like protein
  • Mix1 homeobox (Xenopus laevis)-like 1
  • Mix1 homeobox-like 1 (Xenopus laevis)
  • MIX1 homeobox-like protein 1
  • MIXL1
  • Mix-like homeobox protein 1
  • MIXLMIX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56667
Species: Hu
Applications: ICC/IF
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF2400
Species: Hu
Applications: WB, IHC, ChIP, ICC
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB500-418
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF2085
Species: Hu, Mu
Applications: WB, IHC, ChIP, ICC
NBP2-55308
Species: Hu
Applications: ICC/IF

Publications for MIXL1 Antibody (NBP2-55175) (0)

There are no publications for MIXL1 Antibody (NBP2-55175).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIXL1 Antibody (NBP2-55175) (0)

There are no reviews for MIXL1 Antibody (NBP2-55175). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MIXL1 Antibody (NBP2-55175) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MIXL1 Products

Array NBP2-55175

Bioinformatics Tool for MIXL1 Antibody (NBP2-55175)

Discover related pathways, diseases and genes to MIXL1 Antibody (NBP2-55175). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIXL1 Antibody (NBP2-55175)

Discover more about diseases related to MIXL1 Antibody (NBP2-55175).
 

Pathways for MIXL1 Antibody (NBP2-55175)

View related products by pathway.

PTMs for MIXL1 Antibody (NBP2-55175)

Learn more about PTMs related to MIXL1 Antibody (NBP2-55175).

Blogs on MIXL1

There are no specific blogs for MIXL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIXL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIXL1