MITF Antibody - BSA Free

Immunohistochemistry-Paraffin: MITF Antibody [NBP1-88618] - Analysis in human skin and pancreas tissues using NBP1-88618 antibody. Corresponding MITF RNA-seq data are presented for the same tissues.

Western Blot: MITF Antibody [NBP1-88618] - Analysis in human cell lines SK-MEL-30 and MCF-7 using anti-MITF antibody. Corresponding MITF RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.

Immunohistochemistry-Paraffin: MITF Antibody [NBP1-88618] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: MITF Antibody [NBP1-88618] - Staining of human skin shows moderate to strong nuclear positivity in melanocytes.

Immunohistochemistry-Paraffin: MITF Antibody [NBP1-88618] - Staining of human endometrium shows moderate nuclear positivity in cells in endometrial stroma.

Immunohistochemistry-Paraffin: MITF Antibody [NBP1-88618] - Staining of human liver shows no positivity in hepatocytes as expected.

ChIP-Exo-Seq composite graph for Anti-MITF (NBP1-88618) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MITF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MITF Antibody - BSA Free (NBP1-88618) is a polyclonal antibody validated for use in IHC and WB. Anti-MITF Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MITF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: ChIP reported in scientific literature (PMID: 24443471). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MITF Protein (NBP1-88618PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (87).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MITF Antibody - BSA Free

• bHLHe32
• bHLHe32MI
• Class E basic helix-loop-helix protein 32
• MI
• microphthalmia-associated transcription factor
• MITF
• Waardenburg syndrome, type 2A
• WS2A

Background

MITF (microphthalmia-associated transcription factor) is a melanocytic nuclear protein that contains basic helix-loop-helix (HLH) and leucine zipper (LZ) domains. These protein motifs are frequently observed in other transcription factors and are particularly common to members of the Myc family. MITF can directly associate with DNA as a homodimer. It is required for the development and differentiation of melanocytes. Its expression is upregulated by cAMP and cAMP dependent pathways. MITF activates several different gene promoters by binding to their E-boxes. Tyrosinase, TRP-1 and TRP-2 are pigment synthesis genes activated by MITF. When MITF is phosphorylated on Serine 73 (via the MAPK pathway), it associates with coactivators of the p300/CBP family and enhances transcription. MITF has several isoforms including MITF-M which is specifically expressed in melanocytes. In Mitfdeficient mice there is a complete absence of melanocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MITF Antibody (NBP1-88618)(2)

Publications using NBP1-88618

• Riesenberg S, Groetchen A, Siddaway R et al. MITF and c-Jun antagonism interconnects melanoma dedifferentiation with pro-inflammatory cytokine responsiveness and myeloid cell recruitment. Nat Commun 2015-11-04 [PMID: 26530832] (WB, Human)
• Webster DE, Barajas B, Bussat RT et al. Enhancer-targeted genome editing selectively blocks innate resistance to oncokinase inhibition. Genome Res 2014-05-01 [PMID: 24443471] (Chemotaxis, Human)

Bioinformatics

• Gene Symbol: MITF