MITF Antibody

Images

 
Western Blot: MITF Antibody [NBP1-88618] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: MITF Antibody [NBP1-88618] - Immunohistochemical staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: MITF Antibody [NBP1-88618] - Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in melanocytes.
Immunohistochemistry-Paraffin: MITF Antibody [NBP1-88618] - Immunohistochemical staining of human endometrium shows moderate nuclear positivity in cells in endometrial stroma.
Immunohistochemistry-Paraffin: MITF Antibody [NBP1-88618] - Immunohistochemical staining of human melanoma shows strong nuclear positivity in tumor cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MITF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MITF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MITF Protein (NBP1-88618PEP)
Publications
Read Publications using
NBP1-88618 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%). Human reactivity reported in scientific literature (PMID: 24443471).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MITF Antibody

  • bHLHe32
  • bHLHe32MI
  • Class E basic helix-loop-helix protein 32
  • MI
  • microphthalmia-associated transcription factor
  • MITF
  • Waardenburg syndrome, type 2A
  • WS2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for MITF Antibody (NBP1-88618)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ChIP, WB.


Filter By Application
ChIP
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for MITF Antibody (NBP1-88618) (0)

There are no reviews for MITF Antibody (NBP1-88618). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MITF Antibody (NBP1-88618) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MITF Products

Bioinformatics Tool for MITF Antibody (NBP1-88618)

Discover related pathways, diseases and genes to MITF Antibody (NBP1-88618). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MITF Antibody (NBP1-88618)

Discover more about diseases related to MITF Antibody (NBP1-88618).
 

Pathways for MITF Antibody (NBP1-88618)

View related products by pathway.

PTMs for MITF Antibody (NBP1-88618)

Learn more about PTMs related to MITF Antibody (NBP1-88618).

Blogs on MITF

There are no specific blogs for MITF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MITF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MITF
Entrez