mGluR1 Antibody

Images

 
Immunohistochemistry: mGluR1 Antibody [NBP1-89736] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

mGluR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEEEDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQQQPPPQQKSLMDQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MGLUR1 Protein (NBP1-89736PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for mGluR1 Antibody

  • glutamate receptor, metabotropic 1
  • GPRC1A
  • GRM1
  • GRM1A
  • metabotropic glutamate receptor 1
  • mGluR1
  • MGLUR1A
  • MGLUR1GPRC1AmGlu1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF7387
Species: Hu
Applications: Flow, IHC, CyTOF-ready
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-44999
Species: Hu, Mu
Applications: WB, ICC/IF
H00056899-P01
Species: Hu
NBP1-88323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS921
Species: Hu, Bv
Applications: WB, IHC-P, ICC
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2364
Species: Hu
Applications: WB, IHC
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB5277
Species: Hu
Applications: WB, IHC
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for mGluR1 Antibody (NBP1-89736) (0)

There are no publications for mGluR1 Antibody (NBP1-89736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mGluR1 Antibody (NBP1-89736) (0)

There are no reviews for mGluR1 Antibody (NBP1-89736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for mGluR1 Antibody (NBP1-89736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mGluR1 Products

Bioinformatics Tool for mGluR1 Antibody (NBP1-89736)

Discover related pathways, diseases and genes to mGluR1 Antibody (NBP1-89736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mGluR1 Antibody (NBP1-89736)

Discover more about diseases related to mGluR1 Antibody (NBP1-89736).
 

Pathways for mGluR1 Antibody (NBP1-89736)

View related products by pathway.

PTMs for mGluR1 Antibody (NBP1-89736)

Learn more about PTMs related to mGluR1 Antibody (NBP1-89736).
 

Research Areas for mGluR1 Antibody (NBP1-89736)

Find related products by research area.

Blogs on mGluR1

There are no specific blogs for mGluR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mGluR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRM1
Entrez