AIDA Antibody

Images

 
Western Blot: AIDA Antibody [NBP1-88323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: AIDA Antibody [NBP1-88323] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubules.
Immunohistochemistry-Paraffin: AIDA Antibody [NBP1-88323] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AIDA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AIDA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
AIDA Protein (NBP1-88323PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AIDA Antibody

  • axin interactor, dorsalization associated
  • chromosome 1 open reading frame 80
  • dorsalization-associated protein
  • FLJ12806
  • FLJ32421

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-84530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90944
Species: Hu
Applications: WB, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
AF7387
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88323
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AIDA Antibody (NBP1-88323) (0)

There are no publications for AIDA Antibody (NBP1-88323).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIDA Antibody (NBP1-88323) (0)

There are no reviews for AIDA Antibody (NBP1-88323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AIDA Antibody (NBP1-88323) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AIDA Products

Bioinformatics Tool for AIDA Antibody (NBP1-88323)

Discover related pathways, diseases and genes to AIDA Antibody (NBP1-88323). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIDA Antibody (NBP1-88323)

Discover more about diseases related to AIDA Antibody (NBP1-88323).
 

Pathways for AIDA Antibody (NBP1-88323)

View related products by pathway.

PTMs for AIDA Antibody (NBP1-88323)

Learn more about PTMs related to AIDA Antibody (NBP1-88323).

Blogs on AIDA

There are no specific blogs for AIDA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AIDA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AIDA
Entrez
Uniprot