AIDA Antibody


Western Blot: AIDA Antibody [NBP1-88323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: AIDA Antibody [NBP1-88323] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubules.
Immunohistochemistry-Paraffin: AIDA Antibody [NBP1-88323] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

AIDA Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVS
Specificity of human AIDA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
AIDA Protein (NBP1-88323PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AIDA Antibody

  • axin interactor, dorsalization associated
  • chromosome 1 open reading frame 80
  • dorsalization-associated protein
  • FLJ12806
  • FLJ32421


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PAGE
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu, Ye
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AIDA Antibody (NBP1-88323) (0)

There are no publications for AIDA Antibody (NBP1-88323).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIDA Antibody (NBP1-88323) (0)

There are no reviews for AIDA Antibody (NBP1-88323). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AIDA Antibody (NBP1-88323) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional AIDA Products

Bioinformatics Tool for AIDA Antibody (NBP1-88323)

Discover related pathways, diseases and genes to AIDA Antibody (NBP1-88323). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIDA Antibody (NBP1-88323)

Discover more about diseases related to AIDA Antibody (NBP1-88323).

Pathways for AIDA Antibody (NBP1-88323)

View related products by pathway.

PTMs for AIDA Antibody (NBP1-88323)

Learn more about PTMs related to AIDA Antibody (NBP1-88323).

Blogs on AIDA

There are no specific blogs for AIDA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AIDA Antibody and receive a gift card or discount.


Gene Symbol AIDA