MGAT4A Antibody - Azide and BSA Free

Western Blot: MGAT4A Antibody [NBP3-04923] - Analysis of extracts of various cell lines, using MGAT4A antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MGAT4A Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MGAT4A Antibody - Azide and BSA Free (NBP3-04923) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 28-100 of human MGAT4A (NP_036346.1). QNGKEKLIAYQREFLALKERLRIAEHRISQRSSELNTIVQQFKRVGAETNGSKDALNKFSDNTLKLLKELTSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MGAT4A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MGAT4A Antibody - Azide and BSA Free

• alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
• alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
• EC 2.4.1.145
• GlcNAc-T IVa
• GnT-4a
• GNT-IV
• GNT-IVA
• isoenzyme A
• isozyme A
• mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
• MGAT4A
• N-Acetylglucosaminyltransferase IVa
• N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa
• UDP-GlcNAc:a-1,3-D-mannoside b-1,4-acetylglucosaminyltransferase IV
• UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IVa
• UDP-N-acetylglucosamine:alpha1,3-d-mannosidebeta1,4-N-acetylglucosaminyltransferase

Background

MGAT4A encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme B, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1,4 linkage to the Man-alpha-1,3-Man-beta-1,4-GlcNAc arm of R-Man-alpha-1,6(GlcNAc-beta-1,2-Man-alpha-1,3)Man-beta-1,4-GlcNAc-beta-1,4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MGAT4A