EPB42 Antibody (2G12)

Images

 
Western Blot: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of EPB42 expression in transfected 293T cell line by EPB42 monoclonal antibody (M01), clone 2G12.Lane 1: EPB42 transfected lysate(69.5 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: EPB42 Antibody (2G12) [H00002038-M01] - Analysis of monoclonal antibody to EPB42 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: EPB42 Antibody (2G12) [H00002038-M01] - Detection limit for recombinant GST tagged EPB42 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
2G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EPB42 Antibody (2G12) Summary

Immunogen
EPB42 (NP_000110.1, 623 a.a. ~ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA
Specificity
EPB42 - erythrocyte membrane protein band 4.2 (2G12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPB42
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EPB42 Antibody (2G12)

  • E42P
  • erythrocyte membrane protein band 4.2
  • Erythrocyte protein 4.2
  • erythrocyte surface protein band 4.2
  • MGC116735
  • MGC116737
  • P4.2
  • PA
  • SPH5

Background

Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Rt
Applications: WB, ELISA
NBP2-67279
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-79833
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-33188
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF6868
Species: Hu
Applications: WB, IHC, KO
NB120-10109
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
7270-IL/CF
Species: Hu
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for EPB42 Antibody (H00002038-M01) (0)

There are no publications for EPB42 Antibody (H00002038-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB42 Antibody (H00002038-M01) (0)

There are no reviews for EPB42 Antibody (H00002038-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EPB42 Antibody (H00002038-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EPB42 Products

Bioinformatics Tool for EPB42 Antibody (H00002038-M01)

Discover related pathways, diseases and genes to EPB42 Antibody (H00002038-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPB42 Antibody (H00002038-M01)

Discover more about diseases related to EPB42 Antibody (H00002038-M01).
 

Pathways for EPB42 Antibody (H00002038-M01)

View related products by pathway.

PTMs for EPB42 Antibody (H00002038-M01)

Learn more about PTMs related to EPB42 Antibody (H00002038-M01).

Blogs on EPB42

There are no specific blogs for EPB42, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPB42 Antibody (2G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB42
Entrez
Uniprot