MGAT2 Antibody

Images

 
Western Blot: MGAT2 Antibody [NBP2-14235] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: MGAT2 Antibody [NBP2-14235] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MGAT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNV DKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MGAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MGAT2 Protein (NBP2-14235PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MGAT2 Antibody

  • alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  • Beta-1,2-N-acetylglucosaminyltransferase II
  • CDG2A
  • EC 2.4.1.143
  • GlcNAc-T II
  • GLCNACTII
  • GNT2
  • GNT-IICDGS2
  • Mannoside acetylglucosaminyltransferase 2
  • mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
  • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II
  • UDP-N-acetylglucosamine:alpha-6-D-mannosidebeta-1,2-N-acetylglucosaminyltransferase II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81827
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84299
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-33664
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8864
Species: Hu
Applications: IHC
MAB5469
Species: Hu
Applications: WB, ICC
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-80865
Species: Hu
Applications: IHC, IHC-P

Publications for MGAT2 Antibody (NBP2-14235) (0)

There are no publications for MGAT2 Antibody (NBP2-14235).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGAT2 Antibody (NBP2-14235) (0)

There are no reviews for MGAT2 Antibody (NBP2-14235). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MGAT2 Antibody (NBP2-14235) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MGAT2 Products

Bioinformatics Tool for MGAT2 Antibody (NBP2-14235)

Discover related pathways, diseases and genes to MGAT2 Antibody (NBP2-14235). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGAT2 Antibody (NBP2-14235)

Discover more about diseases related to MGAT2 Antibody (NBP2-14235).
 

Pathways for MGAT2 Antibody (NBP2-14235)

View related products by pathway.

PTMs for MGAT2 Antibody (NBP2-14235)

Learn more about PTMs related to MGAT2 Antibody (NBP2-14235).

Blogs on MGAT2

There are no specific blogs for MGAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MGAT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MGAT2