MOGAT1 Antibody

Images

 
Western Blot: MOGAT1 Antibody [NBP1-59769] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: MOGAT1 Antibody [NBP1-59769] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOGAT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to MOGAT1(monoacylglycerol O-acyltransferase 1) The peptide sequence was selected from the C terminal of MOGAT1. Peptide sequence PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOGAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MOGAT1 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MOGAT1 Antibody

  • Acyl-CoA:monoacylglycerol acyltransferase 1
  • DC2
  • DGAT2L
  • Diacylglycerol acyltransferase 2-like protein 1
  • diacylglycerol O-acyltransferase 2 like 1,2-acylglycerol O-acyltransferase 1
  • Diacylglycerol O-acyltransferase candidate 2
  • EC 2.3.1
  • EC 2.3.1.22
  • MGAT1hDC2
  • monoacylglycerol O-acyltransferase 1DGAT2L1

Background

Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 AF384163.1 1-48 49-1056 BN000154.1 1-1008 1057-1096 AF384163.1 1054-1093

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-75525
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
6507-IL/CF
Species: Hu
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
DDX0130P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-P
NBP1-85230
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69335
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83858
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
7954-GM/CF
Species: Hu
NBP1-59769
Species: Hu
Applications: WB

Publications for MOGAT1 Antibody (NBP1-59769) (0)

There are no publications for MOGAT1 Antibody (NBP1-59769).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOGAT1 Antibody (NBP1-59769) (0)

There are no reviews for MOGAT1 Antibody (NBP1-59769). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOGAT1 Antibody (NBP1-59769) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MOGAT1 Products

Bioinformatics Tool for MOGAT1 Antibody (NBP1-59769)

Discover related pathways, diseases and genes to MOGAT1 Antibody (NBP1-59769). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOGAT1 Antibody (NBP1-59769)

Discover more about diseases related to MOGAT1 Antibody (NBP1-59769).
 

Pathways for MOGAT1 Antibody (NBP1-59769)

View related products by pathway.

Blogs on MOGAT1

There are no specific blogs for MOGAT1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOGAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOGAT1
Uniprot
COVID-19 update