Methylmalonyl Coenzyme A mutase Antibody

Images

 
Western Blot: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Western Blot: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Methylmalonyl Coenzyme A mutase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Methylmalonyl Coenzyme A mutase Protein (NBP1-87423PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Methylmalonyl Coenzyme A mutase Antibody

  • EC 5.4.99.2
  • MCMmethylmalonyl Coenzyme A mutase
  • methylmalonyl CoA mutase
  • Methylmalonyl-CoA isomerase
  • methylmalonyl-CoA mutase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NB200-581
Species: Hu, Rt
Applications: WB, IP
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24600
Species: Hu, Mu
Applications: WB
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423) (0)

There are no publications for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423) (0)

There are no reviews for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Methylmalonyl Coenzyme A mutase Products

Bioinformatics Tool for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423)

Discover related pathways, diseases and genes to Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423)

Discover more about diseases related to Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423).
 

Pathways for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423)

View related products by pathway.

PTMs for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423)

Learn more about PTMs related to Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423).
 

Research Areas for Methylmalonyl Coenzyme A mutase Antibody (NBP1-87423)

Find related products by research area.

Blogs on Methylmalonyl Coenzyme A mutase

There are no specific blogs for Methylmalonyl Coenzyme A mutase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methylmalonyl Coenzyme A mutase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MUT