Methylmalonyl Coenzyme A mutase Antibody - BSA Free

Immunohistochemistry-Paraffin: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Staining of human colon, kidney, liver and pancreas using Anti-MUT antibody NBP1-87423 (A) shows similar protein distribution across tissues to independent antibody NBP2-34024 (B).

Western Blot: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Western Blot: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Staining of human pancreas.

Immunohistochemistry-Paraffin: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Staining of human colon.

Immunohistochemistry-Paraffin: Methylmalonyl Coenzyme A mutase Antibody [NBP1-87423] - Staining of human liver.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Methylmalonyl Coenzyme A mutase Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MMUT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 29511098). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Methylmalonyl Coenzyme A mutase Protein (NBP1-87423PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Methylmalonyl Coenzyme A mutase Antibody - BSA Free

• EC 5.4.99.2
• MCMmethylmalonyl Coenzyme A mutase
• methylmalonyl CoA mutase
• Methylmalonyl-CoA isomerase
• methylmalonyl-CoA mutase, mitochondrial

Background

Methylmalonyl Coenzyme A mutase encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic aciduria. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMUT