MCM6 Antibody

Images

 
Western Blot: MCM6 Antibody [NBP1-82642] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human ...read more
Immunocytochemistry/ Immunofluorescence: MCM6 Antibody [NBP1-82642] - Staining of human cell line U-2 OS shows positivity in nuclei but not nucleoli.
Immunohistochemistry-Paraffin: MCM6 Antibody [NBP1-82642] - Staining of human lymph node shows strong nuclear positivity in reaction center cells.
Western Blot: MCM6 Antibody [NBP1-82642] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCM6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCM6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCM6 Protein (NBP1-82642PEP)
Publications
Read Publications using
NBP1-82642 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCM6 Antibody

  • DNA replication licensing factor MCM6
  • EC 3.6.4.12
  • MCG40308
  • MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S.cerevisiae)
  • MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe)
  • minichromosome maintenance complex component 6
  • minichromosome maintenance deficient (mis5, S. pombe) 6
  • minichromosome maintenance deficient 6 homolog (S. cerevisiae)
  • minichromosome maintenance deficient 6 homolog
  • MIS5 homolog
  • Mis5
  • p105MCM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NBP2-50509
Species: Hu
Applications: IHC, IP
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB200-581
Species: Hu, Rt
Applications: WB, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-06099
Species: Hu
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MCM6 Antibody (NBP1-82642)(2)

Reviews for MCM6 Antibody (NBP1-82642) (0)

There are no reviews for MCM6 Antibody (NBP1-82642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MCM6 Antibody (NBP1-82642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCM6 Products

Bioinformatics Tool for MCM6 Antibody (NBP1-82642)

Discover related pathways, diseases and genes to MCM6 Antibody (NBP1-82642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM6 Antibody (NBP1-82642)

Discover more about diseases related to MCM6 Antibody (NBP1-82642).
 

Pathways for MCM6 Antibody (NBP1-82642)

View related products by pathway.

PTMs for MCM6 Antibody (NBP1-82642)

Learn more about PTMs related to MCM6 Antibody (NBP1-82642).
 

Research Areas for MCM6 Antibody (NBP1-82642)

Find related products by research area.

Blogs on MCM6

There are no specific blogs for MCM6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM6