Mer Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Mer Antibody [NBP2-58025] - Staining of human cell line U-2 OS shows localization to plasma membrane & endoplasmic reticulum. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Mer Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Mer Antibody - BSA Free (NBP2-58025) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MERTK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Mer Recombinant Protein Antigen (NBP2-58025PEP)

Reactivity Notes

Mouse 82%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Mer Antibody - BSA Free

• c-Eyk
• c-mer proto-oncogene tyrosine kinase
• C-mer
• EC 2.7.10
• EC 2.7.10.1
• MER receptor tyrosine kinase
• Mer
• MerTK
• MGC133349
• Receptor tyrosine kinase MerTK
• RP38Proto-oncogene c-Mer
• STK kinase
• tyrosine-protein kinase Mer

Background

MerTK (c-mer, Nyk, Eyk) is a tyrosine kinase that belongs to a family of transmembrane receptors (1). MerTk has been implicated in reversible cell growth arrest, survival, proliferation and cell adhesion. Growth arrest specific protein 6 (Gas6) is an activating ligand for MerTK (2-3). MerTK is required for clearance of apoptotic cells by mononuclear phagocytes in mice; with its absence resulting in progressive lupus like autoimmunity (4). Defects in MERTK are a cause of retinitis pigmentosa (RP) (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MERTK