ARPP-21 Antibody

Images

 
Western Blot: ARPP-21 Antibody [NBP1-90096] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: ARPP-21 Antibody [NBP1-90096] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human lateral ventricle shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Immunocytochemistry/ Immunofluorescence: ARPP-21 Antibody [NBP1-90096] - Staining of human cell line U-2 OS shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARPP-21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQEYT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARPP21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARPP-21 Protein (NBP1-90096PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARPP-21 Antibody

  • 21 kD
  • cAMP-regulated phosphoprotein, 21kDa
  • R3H domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
557-NT/CF
Species: Rt
232-FA/CF
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBL1-12154
Species: Hu
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90096
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARPP-21 Antibody (NBP1-90096) (0)

There are no publications for ARPP-21 Antibody (NBP1-90096).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARPP-21 Antibody (NBP1-90096) (0)

There are no reviews for ARPP-21 Antibody (NBP1-90096). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARPP-21 Antibody (NBP1-90096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARPP-21 Products

Bioinformatics Tool for ARPP-21 Antibody (NBP1-90096)

Discover related pathways, diseases and genes to ARPP-21 Antibody (NBP1-90096). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARPP-21 Antibody (NBP1-90096)

Discover more about diseases related to ARPP-21 Antibody (NBP1-90096).

PTMs for ARPP-21 Antibody (NBP1-90096)

Learn more about PTMs related to ARPP-21 Antibody (NBP1-90096).

Blogs on ARPP-21

There are no specific blogs for ARPP-21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARPP-21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARPP21
Entrez
Uniprot