Melanocortin-4 R Antibody - BSA Free

Immunohistochemistry-Paraffin: Melanocortin-4 R Antibody [NBP1-87567] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.

Immunohistochemistry-Paraffin: Melanocortin-4 R Antibody [NBP1-87567] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: Melanocortin-4 R Antibody [NBP1-87567] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Melanocortin-4 R Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Melanocortin-4 R Antibody - BSA Free (NBP1-87567) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MC4R
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Melanocortin-4 R Protein (NBP1-87567PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Melanocortin-4 R Antibody - BSA Free

• Fatboy
• Glu3
• MC4R
• MC4-R
• melanocortin 4 receptor
• melanocortin receptor 4
• Melanocortin-4 R
• Melanocortin4R
• Melanocortin-4R
• MGC126851
• MGC138197

Background

Melanocortin 4 receptor (MC4R), a Melanocortin Receptor, has been shown to affect food intake and energy balance. Recently MC4R has been shown to modulate erectile function and sexual behavior (Van Der Ploeg et al. 2002).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MC4R