Melanocortin-4 R Antibody


Immunohistochemistry-Paraffin: Melanocortin-4 R Antibody [NBP1-87567] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: Melanocortin-4 R Antibody [NBP1-87567] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Melanocortin-4 R Antibody [NBP1-87567] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Melanocortin-4 R Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQL
Specificity of human Melanocortin-4 R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Melanocortin-4 R Protein (NBP1-87567PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Melanocortin-4 R Antibody

  • Fatboy
  • Glu3
  • MC4R
  • MC4-R
  • melanocortin 4 receptor
  • melanocortin receptor 4
  • Melanocortin-4 R
  • Melanocortin4R
  • Melanocortin-4R
  • MGC126851
  • MGC138197


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Mu
Applications: Flow, CyTOF-ready
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Pm
Applications: WB
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: IHC, IHC-P

Publications for Melanocortin-4 R Antibody (NBP1-87567) (0)

There are no publications for Melanocortin-4 R Antibody (NBP1-87567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melanocortin-4 R Antibody (NBP1-87567) (0)

There are no reviews for Melanocortin-4 R Antibody (NBP1-87567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Melanocortin-4 R Antibody (NBP1-87567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Melanocortin-4 R Products

Bioinformatics Tool for Melanocortin-4 R Antibody (NBP1-87567)

Discover related pathways, diseases and genes to Melanocortin-4 R Antibody (NBP1-87567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melanocortin-4 R Antibody (NBP1-87567)

Discover more about diseases related to Melanocortin-4 R Antibody (NBP1-87567).

Pathways for Melanocortin-4 R Antibody (NBP1-87567)

View related products by pathway.

PTMs for Melanocortin-4 R Antibody (NBP1-87567)

Learn more about PTMs related to Melanocortin-4 R Antibody (NBP1-87567).

Research Areas for Melanocortin-4 R Antibody (NBP1-87567)

Find related products by research area.

Blogs on Melanocortin-4 R

There are no specific blogs for Melanocortin-4 R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Melanocortin-4 R Antibody and receive a gift card or discount.


Gene Symbol MC4R