Melan-A/MART-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Analysis in human skin and liver tissues using HPA048662 antibody. Corresponding MLANA RNA-seq data are presented for the same tissues

Western Blot: Melan-A/MART-1 Antibody [NBP2-33535] - Analysis in human cell lines SK-MEL-30 and PC-3 using anti-MLANA antibody. Corresponding MLANA RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Melan-A/MART-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Melan-A/MART-1 Antibody - BSA Free (NBP2-33535) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MLANA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:100
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Sk-Mel-28 lysate as sample; separated by size; antibody dilution of 1:100; observed molecular weight was 23 kDa; matrix was 12-230 kDa; detected by Chemiluminescence.
• Control Peptide:

  Melan-A/MART-1 Protein (NBP2-33535PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Melan-A/MART-1 Antibody - BSA Free

• Antigen LB39-AA
• Antigen SK29-AA
• Mart 1 Melan A
• MART-1
• MART1MART-1
• MelanA
• Melan-A
• melanoma antigen recognized by T-cells 1
• MLANA
• Protein Melan-A

Background

MART-1 (Melanoma Antigen Recognized by T cells 1) or Melan-A1 is a newly identified melanocyte differentiation antigen recognized by autologous cytotoxic T lymphocytes. Seven other melanoma associated antigens recognized by autologous cytotoxic T cells include MAGE-1, MAGE-3, tyrosinase, gp100, gp75, BAGE-1, and GAGE-1. Subcellular fractionation shows that MART-1 is present in melanosomes and endoplasmic reticulum.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MLANA
• Uniprot:
  • Q16655()