MED8 Antibody

Images

 
Western Blot: MED8 Antibody [NBP1-89015] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MED8 Antibody [NBP1-89015] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Western Blot: MED8 Antibody [NBP1-89015] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MED8 Protein (NBP1-89015PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED8 Antibody

  • ARC32subunit 8 homolog
  • mediator complex subunit 8mediator of RNA polymerase II transcription, subunit 8 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-17257
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
AF5089
Species: Hu
Applications: WB, IHC
NBP1-91810
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-38118
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
H00001831-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-24569
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, Simple Western, IHC-P
NBP1-87006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009440-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58690
Species: Hu
Applications: ICC/IF
NBP2-31639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-85104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MED8 Antibody (NBP1-89015) (0)

There are no publications for MED8 Antibody (NBP1-89015).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED8 Antibody (NBP1-89015) (0)

There are no reviews for MED8 Antibody (NBP1-89015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MED8 Antibody (NBP1-89015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED8 Products

Bioinformatics Tool for MED8 Antibody (NBP1-89015)

Discover related pathways, diseases and genes to MED8 Antibody (NBP1-89015). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED8 Antibody (NBP1-89015)

Discover more about diseases related to MED8 Antibody (NBP1-89015).
 

Pathways for MED8 Antibody (NBP1-89015)

View related products by pathway.

PTMs for MED8 Antibody (NBP1-89015)

Learn more about PTMs related to MED8 Antibody (NBP1-89015).

Blogs on MED8

There are no specific blogs for MED8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED8