MED17 Antibody (4D4)

Images

 
Western Blot: MED17 Antibody (4D4) [H00009440-M01] - CRSP6 monoclonal antibody (M01), clone 4D4 Analysis of CRSP6 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: MED17 Antibody (4D4) [H00009440-M01] - Analysis of monoclonal antibody to CRSP6 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: MED17 Antibody (4D4) [H00009440-M01] - Analysis of monoclonal antibody to CRSP6 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.2 ug/ml.
Sandwich ELISA: MED17 Antibody (4D4) [H00009440-M01] - Detection limit for recombinant GST tagged CRSP6 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
4D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MED17 Antibody (4D4) Summary

Immunogen
CRSP6 (AAH21101, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL
Specificity
CRSP6 - cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MED17
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using H00009440-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MED17 Antibody (4D4)

  • Activator-recruited cofactor 77 kDa component
  • Cofactor required for Sp1 transcriptional activation subunit 6
  • cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa
  • CRSP6FLJ10812
  • CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD)
  • DRIP77
  • DRIP80ARC77
  • mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component
  • mediator of RNA polymerase II transcription subunit 17
  • Thyroid hormone receptor-associated protein complex 80 kDa component
  • Transcriptional coactivator CRSP77
  • Trap80
  • TRAP80CRSP complex subunit 6

Background

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5520
Species: Hu, Mu
Applications: WB
NBP2-56318
Species: Hu
Applications: ICC/IF
NBP1-91189
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP, ChIP
H00010001-D01P
Species: Hu, Mu
Applications: WB
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-337
Species: Hu, Mu
Applications: WB (-), ChIP, IP
H00009443-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
NBP1-87818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, PEP-ELISA, KD
NBP2-34162
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
NBP1-98585
Species: Rt
Applications: WB
NB100-74599
Species: Hu, Mu
Applications: WB, IP
NBP2-67401
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MED17 Antibody (H00009440-M01)(2)

Reviews for MED17 Antibody (H00009440-M01) (0)

There are no reviews for MED17 Antibody (H00009440-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED17 Antibody (H00009440-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MED17 Products

Bioinformatics Tool for MED17 Antibody (H00009440-M01)

Discover related pathways, diseases and genes to MED17 Antibody (H00009440-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED17 Antibody (H00009440-M01)

Discover more about diseases related to MED17 Antibody (H00009440-M01).
 

Pathways for MED17 Antibody (H00009440-M01)

View related products by pathway.

PTMs for MED17 Antibody (H00009440-M01)

Learn more about PTMs related to MED17 Antibody (H00009440-M01).
 

Research Areas for MED17 Antibody (H00009440-M01)

Find related products by research area.

Blogs on MED17

There are no specific blogs for MED17, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED17 Antibody (4D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol MED17
Entrez
OMIM
Uniprot